“One of my goals in life is to do the slowest Primary Series anywhere… rather than the quickest”. Richard Freeman

Friday, 1 June 2012

Asana and Vinyasa : Ramaswami's June 2012 Newsletter

June 2012 Newsletter from Srivatsa Ramaswami—ASANA AND VINYASA

I am now in Vancouver, Canada teaching at Suzanne and Ryan's One Yoga
Studio, a beautiful facility. Presently I am teaching a five day 25
hour Certificate Program on Core Viyasakrama Asanas. We have a
compact enthusiastic group--very nice, warm yogis. The weekend I will
be teaching a workshop here on “Asana Pranayama. Mantras and
meditation” for a comprehensive daily practice involving the major
angas of Ashtanga Yoga.

The registration for my 200 hour Vinyasakrama Yoga Program at Loyola
Marymount University starting July 8th 2012 is as usual slow but
steady. Here is the link.

Early May, I was at Esalen Institute, California and taught a
practicum on Raja Yoga and Hata Yoga to a very compact group of Yoga
practitioners. It was 26 hr program spread over 6 days. It had
different asanas, then Viloma Ujjayi Pranayama and Meditation and
brief discussions on the theory of Hata Yoga and Raja Yoga. I thought
the program went well.

About five years ago when I started offering a 200 Hr Teacher Training
Program, I mainly wanted to cover a broad range of subjects Sri
Krishnamacharya taught me. I thought that to have an appreciation of
the depth and breadth of Krishnamacharya's teachings Asanas alone will
not do. But then even the asanabhyasa of Krishnamacharya was
distinctly different from the general contemporary Yoga as his was
based on traditional concepts of Yoga again based on teachings of such
great works as Patanjali's Yoga Sutras and his unique interpretation
of the Sutras and tradition and accepted authority. In what way was
his yogabhyasa different and distinct? I have written about it on
different occasions but I thought it would be good to put up the ideas

There are hundreds of asanas in vogue, some standing like the famous
Virabhadrasana, lying down like apanasana, prone ones like
dhanurasana, inversions like Sarvangasana, which are practiced avidly
by yogabhyasis by the thousands all over the world, and have been for
generations. However the word asana, coming from the sanskrit root aas
'to sit', refers to a seated posture basically. Asana  means to be
seated or be in a seated position, as a good seated position was
considered essential for yogis to meditate for long hours and be in
Samadhi for a long time. It required that the Yogis had to discover
seated postures that would give comfort and stability and a few
classical poses came in to prominence. Padmasana,lotus pose, Virasana,
the hero pose,swastikasana are some such poses that have been
practiced for a very long time and reference to them can be found  in
itihasas and puranas. Svatmarama in Hatayogapradipika implies use of a
seated yoga posture for pranayama. One should firmly sit in a posture
and have moderate nourishing/easily digestible food and practice
pranayama as instructed by the Guru. Brahma sutras also mandates a
seated yogic posture for meditation.

It may be safe to infer that the asana word mentioned in the Yoga
Sutras as part of the Ashtanga Yoga system of Yoga  indicates a seated
pose. Asana is a position of the body in which one can be
comfortable(Sukha). The other parameter which  defines asana is sthira
or steadiness. It  also indicates a considerable duration. An asana is
a seated pose in which one can remain comfortable for a long time.
What to do in an asana? One would engage in the practice of other
angas from then on, like Pranayama, Pratyahara, and then the three
phased internal practices or antaranga sadhana of dharana, dhyana and
samadhi. Ultimately the yogi is able to transcend even that state of
ordinary object-based samadhi and reach a state of Nirodha which is
termed a state beyond the internal practice or athyangaranga.
Basically all are said to take place while the Yogi is in a seated
position called Asana.

So the purpose of learning asana anga is to be able sit for a long
time in a yogic posture, initially at least to be able to do a round
of uninterrupted Pranayama. What postures are good for that?
Traditionally, asanas like Padmasana, Siddhasana,Swastikasana
Vajrasana/ Virasana or Gomukhasana will meet the requirement.
Vajrasana and Virasana are perfectly balanced poses. Padmasana and
Sidhhasana are resorted to by yogis in large numbers as per tradition.
How to get into the posture in the first place and then be able to
remain in it comfortably and steadily for a long time? Someone defined
asana as a procedure to forget the body, not to be disturbed by bodily
distractions-like an ache here, an overstretch there, some numbness
somewhere, a silent injury in some other place.....

According to Sri Krishnamacharya the way to attain such perfection in
postures is to approach asana abhyasa following the vinyasakrama. He
would aver both during his teaching and in his books,  that asana
practice should be done with vinyasas to be able to achieve the asanas
siddhi, the ability to not just get into a posture somehow but, stay
in it comfortably and for the required length of time. Patanjali in
the II chapter 47 sutra gives the parameters for attaining asanasiddi
characterized by  stability/endurance and comfort. The two parameters
referred to in this sutra are prayatna saitilya and ananta samapatti.

Sri Krishnamacharya taught me yogasanas for several years following
the vinyasakrama. One of the main ingredients of his teaching was the
use of breath in asana vinyasas. I started studying with him when I
was 15 and studied with him until I was approaching 50. Invariably he
taught asanas with vinyasas and with the accompanying breathing. Every
expansive movement will start with an inhalation which would continue
smoothly until the completion of the movement 5 to say 10 seconds
long. Likewise every contraction movement like a forward bend or a
twist will start with an exhalation which exhalation would continue
with the movement until completion of the movement.
Inhaaaaaaaaaaaaaaaale he wold say as he would ask you to raise the
arms in a posture, say Tadasana, Parvatasana or Vajrasana, and
exhaaaaaaaaaaaaaaaaaale he would thunder as he would ask you to lower
your arms in the same postures. He would ask you to keep attention on
the breath, “follow the breath” he would say repeatedly. These two
instructions in the vinyasa asana practice continued  throughout  all
my 1 on 1 classes with him.

Somewhere along, one day I asked my Guru if there are any texts that
mention the use of breath in asana practice. Here is what I wrote in
Namarupa a few years back on this as part of an article on “My studies
with Sri T Krishnamacharya. [http://www.namarupa.org/magazine/nr06/
downloads/05_NR6-Srivatsa.pdf read the whole article]

Vinyása Krama was the mainstay of Krishnamacharya’s teaching of Hata
Yoga. The word vinyása is used to indicate an art form of practice.
This word is used in several arts, especially in South Indian Carnatic
music, a fully evolved classical music system. Vinyása Krama indicates
doing ásana with multiple aesthetic variations within the prescribed
parameters. Yoga was considered one of sixty-four ancient arts. Hence
if you approach yoga ásana practice as an art, that methodology is
Vinyása Krama. The beauty and efficacy of yoga is eloquently brought
out by Vinyása Krama.
What about breath synchronization, another important ingredient of
Krishnamacharya’s Vinyása Krama? What about mental focus on the breath
while doing ásana practice, central to vinyása yoga? None of the yoga
schools teaches yoga in this manner and no classic HathaYoga texts
mention breath synchronization in ásana practice specifically. Where
can one find references to these?

This was one of the few questions I asked my guru: Is Vinyása Krama an
old, traditional practice? Sri Krishnamacharya quoted a verse
indicating that reference to this practice can be found in a text
called Vrddha Sátápata and also in the Yoga Sutras of Patañjali. There
was no point in looking for an obscure text like Väddha Sátápata, but
Yoga Sutra was at hand. But where is the reference? There are hardly
two Sutras explaining ásana, and there is no reference to breath in
them—or is there?
Going back to my notes on Yoga Sutra classes with my guru, I found a
very interesting interpretation of the sutra, Prayatna-saithilya
anantasamápattibhyám. The word prayatna, very commonly used in India,
basically means “effort.” saithilya indicates “softness.” So Prayatna-
saithilya could mean “mild effort”; hence you find that many writers
on the Yoga Sutras declare that the way to achieve perfection in a
yoga posture is to “ease into the posture effortlessly.” This is
easier said than done. There are hundreds of practitioners who cannot
relax enough to be able to easily get into a posture like the Lotus,
for example. So we have to investigate the meaning of the word
prayatna as used by the darsanakáras in those days. Prayatna according
to (Navya)Nyáya, a sibling philosophy to yoga, is a bit involved.
Nyáya explains prayatna of three kinds (prayatnaê trividhaê proktam).
Two of them are the effort put in for happiness (pravätti) and the
effort to remove unhappiness (nivätti). Every being does this all the
time. One set of our efforts is always directed toward achieving
happiness and the other toward eradicating unhappiness. But the third
type of effort relevant here is the effort of life (jàvana-prayatna).
What is effort of life? It is the breath or breathing. Now we can say
that prayatna-saithilya is to make the breath smooth. Thus in ásana
practice according to Vinyása Krama, the breath should be smooth and
by implication long (dàrgha).

The other part of the sutra refers to samápatti, or mental focus.
Where or on what should the mental focus be? It is to be on ananta
(ananta-samápatti). Now we have to investigate the contextual meaning
of the word ananta, translated as “endless” or “limitless,” which many
writers equate with infinity. So some schools tend to say that while
practicing ásanas, one should focus the attention on infinity, which
is inappropriate—and impossible, at least for the vast majority of
yogàs. Ananta also refers to the serpent, Ädisesa, whose incarnation
Patañjali is believed to be. So some schools suggest that one should
focus on a mental image of Ädisesa or Patañjali. It may be possible,
but it is uncomfortable to think that Patañjali would write that one
should focus on his form for the success of ásana practice. So what
might ananta symbolically signify? The word ananta can be considered
to be derived from the root, “ana”—to breathe (ana sváse). We are all
familiar with the group of words--prána, apána, vyána, etc., names of
the five pránas derived from the root “ana.” So in the sutra, ananta
could mean “breath”; ananta-samápatti is then translated as “focusing
the mind on the breath.” In fact Ananta, or the serpent king, is
associated with air. In mythology the cobra is associated with air;
there is a common mythological belief that cobras live on air. If you
look at the icon of Natarája (the dancing Siva), you will find all
five elements of the universe (earth, water, air, fire, and space)
represented symbolically in Siva. The matted red hair represents fire,
the Gangá in his tresses, the water element; the air element is said
to be represented by the snake around the Lord’s neck. So ananta-
samápatti would mean focusing the attention on the breath or prána.

Thus this sutra means that while practicing ásana, one should do
smooth inhalations and exhalations and focus the attention on the
breath. Since Vinyása Krama involves several aesthetic movements into
and within yoga postures, to achieve the coordination of movement,
breath, and mind, one should synchronize the breath with the movement
with the help of the focused mind. By such practice, slowly but
surely, the union of mind and body takes place, with the breath acting
as the harness.
But why don’t other texts talk about it? There is a saying, “Anuktam
anyato gráhyam.” If some details are missing from one text, they
should be gathered from other complementary texts. Hatha-yoga-
pradàpiká explains a number of ásanas but does not mention breath
synchronization and other basic parameters. But Hatha-yoga-pradàpiká
proclaims that its instructions are like a prerequisite for the Rája
Yoga practice of Patañjali. These two texts are therefore compatible.
Thus we can conclude that Patañjali gives the basic parameters of
ásana practice (and also of the other angas like Pránáyáma), but for
details we have to refer to compatible texts like Haôha-yoga-
pradàpiká,Yoga-Yájñavalkya and others.

My Guru had written a book called “Yogasanangalu” in Kannada, a copy
of which I have had for a long time, but never read it as it is in
Kannada. Of course I have gone through the wonderful asana pictures of
my Guru in it many many times. Recently I found a few pages of the
translation in the blog pages of my friend Antony Hall and I am
reproducing the relevant portion from it hereunder (Thank You Tony)

NOTE: The original version of yogasanagalu has now been translated
One further chapter, added later is still to be translated (Update July 2016 that final chapter may be on it's way soon).

Sri Krishnamacharya wrote:
“Vinayasas” many people are curious about its secret. Some others want
to know its basis. I agree.
“prayatnashithilyanantasamapattibhyam” (Yoga Sutra II 47)

Please see Patanjala yogasutra and Vyasabhashya (P 2, S 47)

Both type of people (practitioners), be happy .

Vachaspathi Misra in that commentary

“Saamsiddhiko hi prayatnah shariradharako na
yogangasyopadeshtavyasanasya kaaranam. Tasmat
upadeshtavyasanasyayamashadhakah virodhi cha swabhavikah prayatnah.
Tasya cha yadruchhikasanahetutayaa sananiyamopahamtyatvat.”

Here is my translation: Surely the innate effort--prayatna-- (in every
being) is to sustain the body (which is prana, Prana and sariradharaka
are considered synonyms). But it (the normal innate breathing) is not
helpful in achieving the task on hand (achieving the yoga pose).
Therefore the natural/involuntary effort/breathing (swabhavika
prayatnah) is counterproductive in achieving the intended goal.
Consequently a man, practicing the specific posture as taught, should
resort to an effort(prayatna) which consists in the relaxation
(saitilya) of the natural/innate(swabhavika) effort (breath).
Otherwise the posture taught cannot be accomplished

Krishnamacharya continues to talk about using breath in asanas.
“Therefore, how many breathings for which asana? When is inhalation?
When is exhalation? In what way? When body is stretched forward,
inhalation or exhalation? What about when you raise your head? To know
this mystery and practice in order is called Vinayasa. These along
with the significance of each asana will be discussed in 1 to 32.”
Why do I do a flurry of Vinyasas?
So that I could sit in a Yogic posture
Firm, for long ,comfortable
Why sit in a Yogic posture?
So I can do Pranayama, Pratyahara
Do Parayana (chant), do dhyana (meditate)
May be then I can get into Samadhi.…
Why do I want to get into Samadhi?
To realize first hand
How intrinsically,immensely
delightfully peaceful
I really am
So why do I do all this
Flurry/Flow of Vinyasas ...?

So what have I been trying to say?

1. Asana in Raja Yoga (Patanjala Yoga) refers to a seated posture in
which the Yogi stays put comfortably and steadily for a long time

2. According to Patanjali and interpreted by Krishnamacharya it is
achieved by Vinyasas done with coordinated /synchronous smooth
breathing and focusing the mind on breath.  While doing the vinyasas,
Sri Krishnamacharya would ask us to breathe with a slight rubbing
sensation in the throat and producing a 'hissing sound' a la cobra—
another aspect of ananta samapatti. As mentioned earlier some
commentators refer to meditating on Ananta (ananta samapatti) and
normally it is done by Sri Krishnamacharya by saying a prayer in
praise of Patanjali at the beginning of a yoga practice session. There
are a few prayers on Patanjali. Sri Krishnamacharya  invariably
chanted the prayers  starting with “yastyaktva rupam..” then “yogena
chittasya..” and “aabahu purusha..” and then “Srimate Anantaya
Nagarajaya Namo Namah” at the beginning of a session while teaching
me, which I follow faithfully.

3. There are hundreds of vinyasas Sri Krishnamacharya taught. To meet
the requirements of different individuals one chooses the appropriate
ones from these. The individual package will depend upon the condition
of the individual and the posture/s one would look to attain siddhi
in. (Here is a commercial. To know and learn more about the myriad
vinyasas, systematically, please refer to my book “Complete Book of
Vinyasa Yoga”)

4. In practice,for the seated asana siddhi, inversions along with the
multitude of vinyasas in them are very helpful to relax and exercise
the lower extremities; so also the joints of the lower extremities
like the ankles, the knees, further up the hips and also the spinal
column. My Guru would ask us to be careful about thighs and waist.
“Never allow the thighs and waist to spread and get out of control”.
“Tape measure these and keep them under control.” And the inversions
with the vinyasas help keep the waistline and thigh size under
control, very essential to achieve seated posture siddhis. Since the
legs play an important role in seated poses these are very beneficial
to attain the sthiratva and sukhatva in seated poses. Further as many
varied vinyasas in scores of other asanas as possible should be
practiced to cover/exercise the whole body comprehensively and with
the bandhas at the end of exhalation and wherever appropriate. Yoga is
considered a sarvanga sadhana or a system that reaches and benefits
all parts of the body including the internal organs. It is achieved by
different vinyasas in different yoga poses, with appropriate breathing
and the bandhas. When a Yogi sits down to start the Pranayama, the
Yogi's whole body should be perfectly prepared with the Vinyasas in
different asanas with smooth mindful breathing. All these to make it
possible for the Yogi to sit comfortably for a long time and
concentrate on the job on hand like Pranayama or meditation and
completely be oblivious  of  the body .

5. A deliberate effort to link the breath with the movement mindfully
(mind/breath unity) will help the asana siddhi as per Patanjali's

6. Sri Krishnamacharya taught asanas with a proviso that it should not
be strenuous, no strain on the heart. Yoga should be helpful for the
heart by the judicious use of breath (respiratory pump effect) and
varied use of vinyasas (muscle pump effect). It is corroborated by a
verse in Hatayogapradeepika. Quoting Gorakshnatha,  Svatmarama says
“varjayet.......kayaklesa vidhim..” It indicates that the yogi should
avoid procedures that put strain/pain (klesa) on the system. Yoga is
to reduce pain or klesa, both physical(kaya klesa) and
psychological(the pancha klesas). Brahmananda in his commentary
explains kayaklesa that should be avoided will include, bahubhara
udvahana or carrying heavy weights and bahusuryanamaskara or
performing multiple sun salutations. Sri Krishnamacharya taught me Sun
Salutation with appropriate breathing with the movements but it was an
optional small part of the routine . Suryanamaskara chanting however
was an important aspect of the vedic chantings he taught me.

7. He also would say that a serious yogi should be krisa or lean. For
a yogi,heaviness caused by fat or lean (muscle) is not helpful.

8. The asanabhyasa I learnt from my Guru was not merely slowing down
the pace of the asana practice but a deliberate practice to slow down
the breathing rate itself. As against the normal breath rate of about
15 per minute, in Vinyasakrama the breath rate is brought down to
about 6 or less per minute during vinyasa practice for most of the
time. Without controlled breathing, the breath rate in many physical
exercises, outdoor games and gym workouts could be much higher than
the normal rate and is the antithesis of vinyasakrama I learnt from my
Guru consistently for many many years. Sri Krishnamacharya had a clear
preference for slowed breathing and advised his serious students not
to participate in activities that tend to increase the heart rate/
breath rate substantially like running etc. even as he had no
objection to walking as an exercise. This advice was of course for
serious yogabhyasis.

9. I remember that once  there was a talk/demonstration on Yoga by Sri
Krishnamacharya , if I remember correct, at  T S, in Adyar, Madras.
Sri Krishnamacharya spoke for a short while and asked someone in the
audience to come and check his pulse rate. It was about 60 or so. Then
Sri Krishnamacharya, sat up and did some pranayama and bandhas a few
times and asked his pulse rate to be checked. It was around 30. Within
a short duration with Pranayama ( and bandhas) he was able to
amazingly reduce the rate substantially.

10.When I was  young I actively participated in outdoor activities. I
even represented my college in three games, Cricket, Table Tennis and
Tennis (Captain). For a few years I was learning Yoga and also playing
outdoor games and I enjoyed both. But soon I realized the distinct
difference in the philosophy of both. While one--aerobics-- encouraged
free breathing, increased metabolism, substantially increased heart
rate during the physical activity, Yoga, at least the Yoga I learnt
from Sri Krishnamacharya encourages, nay mandates, deliberate slower
breathing, and achieve lower heart rate. I think both systems have
their own idiosyncrasies and distinct advantages. Aerobic kind of
exercises, especially the strenuous ones, may I say, tend to flog the
heart, by increasing the heart rate(sometimes even pounding),  breath
rate all of which of course help to strengthen the heart muscles and
develop collateral blood vessels. But then Yoga virtually accesses,
supports, caresses, gently massages and directly aids the heart in its
function. (For more on this please read my article “Yoga For the
Heart”, in my May 2009 Newsletter

11.  So, Yoga may not be practised as a workout with heavy breathing,
profuse sweating and accelerated heart rate . The nicety about
hatayoga is the smooth, long, more complete breathing even while doing
those beautifully flowing vinyasas and asanas and unique Mudras, else
there is physiologically no difference between Yoga and aerobics/
workouts.  And one must admit Sri Krishnamacharya knew a thing or two
about the heart and health. He lived for a hundred years a healthy man
and also, as documented, had shown tremendous control over the heart
and its beat.

Srivatsa Ramaswami

P S. Please write to info@vinyasakrama.com for comments and
suggestions. My earlier Newsletters can be accessed by visiting my
website www.vinyasakrama.com and clicking on the Newsletter tab.

  If I practice asanas alone all my life and expect everything
mentioned in Yoga texts to come to me, then how come Yogis of
yesteryears like Sri Krishnamacharya studied, practised and taught
other yogangas like Pranayama, chanting, meditation , texts and others
in addition to those exquisite yoga postures? Am I missing something
very vital in my lifelong Yoga practice?


  1. Are Ashtanga and/or vinyasa krama is good enough for heart health?

    Every year I have the same conversation with my personal physicaian during my annual physical. D. Do you do any aerobic exercises? Me. No, but I do a dynamic type of yoga. I try to explain what I do, but he never gets it because he has his own image of yoga. D. That’s not enough. You need to increase your heart rate to 140 – 150 to get the aerobic effect. I say OK , but never get around to it. I have not done any other exercise for over 10 years but I feel that I’m in the best shape of my life. Blood work results come out normal including lipids. Few years ago, I even passed a stress test a without breaking a sweat.

  2. Curious the Doctor actually asked about 'aerobic' exercise, here I think they're happy if you just go for a walk. When i saw the doctor with my Kidney stones and mentioned I practised Yoga she said "...perfect, no need to send you to the physio".

    I'm not sure wether the aerobic impression of Ashtanga is a mistaken. In the beginning your getting hot and sweaty and breath perhaps all over the place but that doesn't strike me to be the intention, one reason people get stopped supposedly (when they lose control of their breath at a posture). I've been practising long enough now that I can get through Primary with my breath pretty steady throughout and most of 2nd series too except perhaps for the odd couple of postures, tittibhasana c for some reason, Nakrasana.

    I want to believe that Ashtanga can still be practiced in line with Krishnamacharya's intention.

  3. In the intro to "Power Yoga" by Beryl Bender Birch, she says " with this practice you are training the lungs to increase their volume and uptake while training the heart to increase its efficiency. Studies on advanced practitioners of this yoga system shows that the resultant effects on the heart and lungs are very similar to the effects of aerobic sports- the resting heart rate slows, the capacity of heart and lungs to deliver oxygen to muscles increases, and the anaerobic threshold moves further away."

    The above analysis makes logical sense to me. I was wondering if anyone has come across published results?

    Grimmly, I have started to practice Ashtanga at a slower pace with deeper breathings and beginning to enjoy it even more. You have charactrized it correctly as Krishnamacharya's intentions.

  4. The points above re: ashtanga bring to mind how the breaths per asana decreased as more and more people went to Mysore. It seemed to go from 25 breaths for therapy, to 8 breaths, to 5 and then 3 breaths. It seems most Mysore classes now teach 5 breaths. I tend to think the more breaths one takes per asana, the slower the overall rate will be. However, this also increases the length of the practice, which for most working people doesn't work well. I know I have difficulty fitting in my practice in the mornings from 4-6 am, prior to leaving for work. If I sleep too long, the whole practice has to be truncated. Is there anyone out here who practices ashtanga with 8 or more breaths? If so, how is your breathing rate affected?




!0 ways ashtanga changed. (1) . Richard freeman Workshop (1) ((% includes theory (1) (OA) (1) ‪#‎proficientprimaryproject‬ (4) %Arabica (1) < manju (1) 10 point way to health (1) 10 second exhalation (2) 10 second inhalation (3) 10 second inhale (1) 10-15 second inhalation/ exhalation (1) 100 years of beatitude (1) 1008 (1) 108 dropbacks (1) 108 dropbacks. (1) 108 sun salutations (1) 17 meanings of yoga (1) 2000 asana (1) 21 Things to know before starting an ashtanga practice (1) 21st century yoga (1) 2nd series (4) 2nd series headstands (1) 2nd series list (1) 3rd edition Vinyasa Krama Practice Book (2) 3rd series (18) 4th series (4) 5% theory (1) 7 deadlies. (1) 80 rounds Pranayama (1) 95% practice (1) 99%practice 1% theory (1) A. G. Mohan (2) A.G. Mohhan (1) Abernathy butter (1) aches and pains (1) Achieving full lotus. (1) acro yoga (1) Acupuncture (1) adhomukha padmasana (1) adhomukha svanasanas (1) Adi Shankara (1) Adjusting (3) Adjusting postures. (1) Adjustments (1) Adjustments/assists (1) Advaita (1) Advanced A (6) Advanced A B C D list (1) Advanced Ashtanga (2) advanced B (3) Advanced backbending (1) advanced series (2) Advanced series ashtanga (1) Advanced series in primary and Intermediate (1) Advanced standing sequence (1) AG Mohan (4) Ahtanga (1) Ajaan Lee (1) Ajay Tokas (1) Ākāśa (1) Al-Biruni' Yoga Sutras (1) Alessandro Sigismondi (1) Alex Medin (2) Alica Jones (1) alignment (1) Alternative to sun salutation (1) alternative to upward facing dog. practicing with wrist problem (1) alternatives to asana (1) alternatives to headstand (1) Amanda Manfredi (2) Anandavalli (1) Angela Jamison (5) Anjeneyasana Sequence (1) Anne Nuotio (1) ansura (1) Ante-natel Yoga (3) Antenatal Vinyasa krama (1) Antenatal yoga (1) Anthar Kumbhakam (1) Antharanga Sadhana (1) any benefits to advanced asana (1) aparigraha (1) Aparokshanubhuti (1) applied anatomy and physiology of yoga (1) April fool. (1) Aranya (1) Ardha baddha padma eka pada raja kapotasana (1) Ardha Baddha Padma Paschimattanasana (1) ardha matsyendrasana (1) Ardhomukhasvanasana (1) Ariadne's thread (1) arm balances (4) arthritis (1) Aruna Elentari (1) asana (1) Asana and ageing (1) asana and sweat (1) asana as gesture (1) asana as mudra (1) asana lists (1) Asana madness (3) Ashmolean Museum of Art and Archaeology (1) Ashtanga (20) Ashtanga 2nd series (1) Ashtanga 3rd (1) Ashtanga 3rd series (1) Ashtanga 4th series. (1) Ashtanga 6th series (1) Ashtanga A (1) Ashtanga adjustments (2) Ashtanga Advanced A (2) Ashtanga Advanced series (1) Ashtanga Advanced series. Pattabhi Jois (1) ashtanga and age (2) ashtanga and ageing (1) Ashtanga and Boredom (1) Ashtanga and Drug Addiction (1) Ashtanga and fun (1) Ashtanga and kumbhaka (1) Ashtanga and menstruation (1) Ashtanga and motherhood (1) Ashtanga and pregnancy (1) Ashtanga and Socrates (1) Ashtanga and Sweat (1) Ashtanga and the wrist (1) Ashtanga and Vinyasa krama yoga Maidenhead (1) Ashtanga and Zen (2) Ashtanga as it was (2) Ashtanga assists (1) Ashtanga assists. (1) ashtanga authorisation (1) Ashtanga B (1) ashtanga backbends (1) ashtanga backbernding (1) Ashtanga books (3) Ashtanga C (1) Ashtanga certification (1) Ashtanga changes (1) Ashtanga cheat sheets (1) ashtanga class size (1) Ashtanga Comparison (1) Ashtanga conference (1) Ashtanga demo (1) Ashtanga demonstration (1) Ashtanga differences (1) Ashtanga dispatch (1) Ashtanga DVD's (1) Ashtanga finishing sequence (1) Ashtanga for beginners (1) Ashtanga history (9) Ashtanga history. (1) Ashtanga illustrations (1) Ashtanga in Europe (1) Ashtanga in Greece (3) Ashtanga in midlife (1) Ashtanga in Mysore (1) Ashtanga in Osaka (1) Ashtanga in the 80s (1) Ashtanga interviews (1) Ashtanga Japan (1) Ashtanga jump back (1) Ashtanga Ladies holiday (1) ashtanga legitimacy (2) Ashtanga lineage (3) Ashtanga Maidenhead (1) Ashtanga Moscow (1) Ashtanga nothing to fear. (1) Ashtanga Parampara (6) Ashtanga pranayama sequence (1) Ashtanga pranayama. (1) Ashtanga primary (1) Ashtanga primary series list (1) Ashtanga primary to advanced series (1) Ashtanga reading list (1) Ashtanga Rishi approach. (10) Ashtanga roots in yoga makaranda (1) Ashtanga Saadhana (1) Ashtanga source (1) Ashtanga syllabus (1) Ashtanga talk through (1) Ashtanga teacher Authorisation (1) Ashtanga terminology (1) Ashtanga tradition (1) Ashtanga TV spot (1) Ashtanga TVAM (1) Ashtanga videos (1) Ashtanga vinyasa (3) ashtanga vinyasa count. (1) Ashtanga Vinyasa Krama (35) Ashtanga while on period (1) Ashtanga Yoga (1) Ashtanga Yoga Anusthana (2) Ashtanga yoga Bali (1) ashtanga yoga confluence (6) Ashtanga yoga Confluence Eddie Stern (1) Ashtanga yoga greece (1) Ashtanga Yoga in the tradition of Sri K Pattabhi Jois (1) Ashtanga yoga london (1) Ashtanga yoga manual (1) Ashtanga yoga Moscow (1) Ashtanga Yoga Peru (1) Ashtanga Yoga School Moscow (3) Ashtanga young boys (1) Ashtanga.com article links (1) Ashtanga's origins (1) Ashtangaparampara (1) Ashtangi interviews (1) Assisting (3) assists (1) astanga (1) Aṣṭāṅga (1) Astanga Yoga Anusthana (1) Aṣṭāṅga Yoga Anuṣṭhāna (1) Astavakrasana (1) asymm (1) Asymmetric (1) Asymmetric asana (1) asymmetric sequence (1) Atma Suddhi mantras tutorial (1) Authorisation (1) AVIDYA (1) AVKY at Home (1) AY:A2 (1) ayc (5) AYC Videos (2) B.N.S. Iyengar (1) B&W yoga videos (1) back bending (3) back bending back bending (1) back bending. (1) back pain (4) back pain lumber region (1) back pain. floating (1) Back problem (1) backbend (1) backbending (7) backbending exercises (1) Backbending prep (1) backbends (4) backbends / dropbacks (73) baddha konasana (4) baddha padmasana (2) badha matsyendrasana (1) badha padmasana (1) Bahauddin Dagar (1) Bakasana (6) balance (1) Bali conference (1) Bandhas (13) bansuri (1) Bansuri Holliger (t)air(e) for solo flute (1) Basti. Neti (1) Beginner Ashtanga (1) beginner yoga reading list (1) Beginning Ashtanga (2) beginning Vinyasa krama (1) beginning vinyasa yoga (1) beginning yoga (2) Being in the World (3) being stopped at a posture (1) benefits of advanced asana (1) best Ashtanga books. (1) best Coffee in Japan (1) Best Coffee in Kyoto (1) best jump back (1) best jump through (1) bhagavad gita (7) Bhagavadagita (2) Bhagavan Das (2) Bharadvajrasana (2) Bharatanatyam (2) Bhaya Kumbakam (1) Bhoja's commentary on Yoga sutras (1) bhuja pindasana (1) Big people can do you (1) Bikram (2) bikram yoga (1) biography of Krishnamacharya (1) Birdwatching (1) Birth & Motherhood (1) birthday (1) BKS Iyengar (3) Bliss (1) blog to book (1) Blogbooker (1) Blogsy (1) BNS Iyengar (3) Body clock (1) Body image (1) Bohr effect (1) Book review (3) Born again Ashtangi (1) bow (1) Bow sequence (9) BRAHMASANA (1) breath (2) Breath control (1) breath holding (1) breath is nice (1) Breath of god (1) Breath of gods (1) Breath of the Gods (3) Breath of the Gods – A Journey to the Origins of Modern Yoga (1) breath retention in asana (1) Breathing (2) breathing asana (1) breathing less (1) breathing rate in ashtanga (1) British Yoga in the 1950`s and 60`s (1) Bruce lee (1) Bruges (1) Buddhasana (3) Budokan yoga (1) Burmese buddhism (1) cakra (2) Camel walk (3) Carbon Monoxide poisoning (1) Casa vinyasa (1) caturanga Dandasana (1) cave (1) chakea (1) Chakorasana (1) chakra (2) chakra bandhasana (4) Chakra meditation (1) Chakras (3) chakrasana (6) championship yoga (1) Chan meditation (1) Changes (1) Chanting (9) chanting in asana (1) Chanting the yoga sutras. (1) chanting yoga sutras (2) chatauranga dandasana (2) chaturanga (1) Chinese medicine and Ashtanga (1) chitta vritti (1) Chittavijana of Yogasanas (1) choosing an Ashtanga book (1) Christian yoga (1) Christmas practice. (2) chuck Miller (6) cit (1) cittavritti (1) classical yoga (1) Claudia and James Kripalu workshop (1) Cley (1) Clifford Sweatte (1) Coleridge (1) Coltrane (1) coming up (1) Common yoga protocol (2) comparison of drishti (1) concentration practice (1) conference notes (1) Conference notes. (1) Consciousness (1) Contemplation (2) Contemplative Sciences Centre (1) Contemplative Studies department (1) Contemporary yoga Culture (1) cooking (1) Creative Commons (1) Crete (2) current practice (2) cybershala (1) Daily routine of a yogabhyasi (1) Danny Paradise (3) Dasha diirgha rechaka puuraka (1) David Garrigues (7) David Garrigues Intermediate DVD (1) David Keil (2) David Robson (5) David Robson's learn to float drums. (1) David Roche (1) David Swenson (7) David Williams (5) Dearbhla Kelly (1) Debbie Mills (1) dedicated practice (1) Deepdale Camping (1) defence of Ashtanga (1) degenerative arthritis (1) deindividuation (1) Deleting a blog (1) Dena Kingsberg (2) Der Atmande Gott (1) Der Atmende gott (2) Derek Ireland (13) Desikachar (1) desk pose (1) Detox (3) developing a Home practice (42) Development of Ashtanga series (1) devotion (1) devotion to practice (1) dhanurasana (2) Dharana (6) Dhāraṇā (2) Dharana focal points (1) Dhouti (1) Dhouti kriya (1) Dhyana (3) Did Krishnamacharya speak English (1) Dido and Aeneas (1) Dido's lament (1) die (1) diet (3) Differences in Ahstanga (1) Ding namaskara (1) discernment (1) discipline (6) Dmitry Baryshnikov (1) Do we need an Advanced series (1) does sweating detox (1) downward dog (1) Dr N Sjoman (1) Dr Norman Sjoman (1) Dr. Norman Sjoman (1) dream (1) Drisht (1) drishti (6) dropback (1) dropback prep (1) Dropback progress videos Aug 08 to Present (1) dropback ritual (1) dropback routine (1) dropbacks (1) dropping back (2) Duhkha (1) Durvasana (1) dwi pada sirasana (1) dwi pada sirsasana (2) Dwipada Sirsasana (1) dwipadapitam (2) dwipadasirsasana (1) early asana diploma course (1) Early Ashtanga (1) Early Ashtanga yoga article (1) Early pattabhi jois (1) Easter Krishnamacharya retreat (1) Eddie and Jocelyn Stern (1) Eddie Stern (6) effulgence (2) Egyptian backbend picture (1) Eihei Dogen (1) Eiko Saito (1) Eka pada chakra bandhasana (1) Eka pada raja Kapotasana (2) eka pada series (11) eka pada sirsasana (1) eka para baddha padmasana (1) EKAPADA VIPARITAKARANI (1) elephant jornal (1) Emergence du Yoga (1) Emergence of Yoga (5) Emurgence du Yoga (1) Encinitas (1) Encinitas yoga in schools debate (1) Equinox (1) errors in current ashtanga practice (1) Evening practice (2) evening practice. (1) Evolution of Ashtanga (2) Evolution of Ashtanga yoga (1) extended stays (2) extended stays in asana (1) Facebook (1) falling (1) FAT PEOPLE CAN'T DO YOGA? Fat people Can do Yoga (1) Father Joe Pereira (2) feet together dropback (1) feetup (1) femurs (1) First led Ashtanga class ever (1) First practice of 2012 (1) five koshas (1) five sheaths (1) Flexibility in Ashtanga (1) Flexibility within Ashtanga (1) float to handstand (1) floods (1) flotation tank yoga (1) flute (1) Forest tradition (1) formal savasana (1) four Immeasurable and yoga (1) four Immeasurable and yoga sutras (1) four immeasurables (1) four key asana (1) franney and Zooey (1) full vinyasa (6) Functional Anatomy (1) Fusion magazine tribute (1) Ganda Bherundasana (2) Gandha bhandasana (1) Gandha Bherundasana (2) Ganeseha prayer (1) Ganesh Mohan (1) Ganesha prayer (2) Garbha Pindasana (6) gayatri (1) Gayatri chant (2) gayatri japam (1) Georg Feuerstein (1) getting in to full lotus (1) Gil Frondsal (1) Gingi Lee (2) gita as it was (1) Grechikha (1) green smoothie (1) green smoothies (1) Gregor Maehle (12) Grimmplys Vinyasa Krama Practice Book (1) Guest Vinyasa krama practice (2) Gunas (2) Guru on the Grounds (1) Guru to Go (1) Guru's of Modern Yoga (1) guruji (9) Guruji asana (1) Guruji asana photos (1) Guruji in Copenhagen (1) Guruji London 2002 (1) Guruji London tour 2002 (1) Guruji peforming puja (1) Guy Donahaye (2) Gymnast wrist (1) halasana (1) Half Ashtanga series (1) Halogen heater (1) Hamish Hendry (2) Hampton Court (1) hands free lotus (2) handstand drop over (1) handstands (3) hanumanasana (8) Harvard Healthy eating plate (1) has yoga evolved (1) hatha and Raja yoga (1) hatha yoga (1) Hatha yoga pradipka. Aranya (1) headstand (20) headstand prop (1) headstand variations (1) headstand variations. (1) headstands (2) healing through bandhas (1) healing through Kumbhaka (1) Health healing and Beyond (1) heart of the practice (1) heart stopping (1) heart stopping experiment (1) Heather Morton (3) Heidegger (3) Heidegger and Yoga (1) Hesychasm (2) hesychast method (1) hidden asana (1) hidden postures between postures. (1) Hippies (1) Hippy (1) History of Asana (1) History of Ashtanga (2) history of Yoga (1) Holderlin (1) holding somebody back in ashtanga (1) holding the breath in asana (1) Holiday (1) Holiday practice (3) home ashtanga practice (1) Home practice (5) home practice. (1) home shala (1) home v shala practice. (1) Home yoga practice (1) hot yoga (1) House recommendations (2) How Ashtanga changed (1) How I met Guruji (1) How mauch to become and Ashtanga teacher (1) How old is Ashtanga Vinyasa (1) How old is Ashtanga? (1) how to breath in asana (1) how to chant the yoga sutras (1) How to do a headstand (3) how to do lotus (1) how to get into lotus (1) How to learn pranayama (1) how to meditate (1) How to practice Vinyasa krama (3) Hyon Gak Sunim (2) i Dhyana (1) ideal Mysore self practice room. (1) II-47 (1) Illnes (1) Ilya Zhuralev (1) Improvisation (1) in defence of ashtanga (1) in defense of asana (1) India (2) Indian cosmology (3) Indian dance (1) Indian evolution (3) Indian measurement (1) Indian music (1) Indian physical culture (1) Indra Devi (2) injuries (10) injury (8) Inner gazing (1) Inside an Imac (1) Intermediate (63) Intermediate series (1) internal drishti (2) International Yoga Day (1) Interviews (2) introduction to Ashtanga (1) introduction to Vinyasa krama (1) introduction to yoga (1) inversions (6) inverted sequence (6) inverted subroutines (9) Invertions. (1) invocation (1) ipod (1) Is Ashtanga a fixed sequence (1) IS Ashtanga a spiritual practice? (1) Is Ashtanga designed for young boys (1) Is Ashtanga hard (1) Is Ashtanga Hatha yoga? (2) Is yoga Indian (1) Ishvara gita (1) Ishvarapranidhana (1) iyengar (8) Iyengar Drop back challenge (6) Iyengar jumping (1) Iyengar practicing ashtanga (1) Iyengar yoga (1) Iyengar. 1938 Krishnamacharya movie (3) Iyengar's ashtanga (1) Iyengar's Library (1) jain yoga (1) jalandhara bandha (3) janu sirsasana (3) Japa mantra (2) jar (1) Jessica Walden (5) Jesus prayer (1) jim through (1) Jivatma (1) Joanne Darby (1) Joey Mills (1) John cage (1) John Campbell (1) john Scott (8) John Scott workshop (1) John Scott's Ashtanga App. (1) Jois (1) Jois led intermediate (1) Jois led primary (1) Jois Yoga (1) JoisYoga (1) jump back (1) Jump back jump through (59) Jump back library (1) Jump back monthly progress videos Feb 08 to present (1) Jump back Screenshots (5) jump back seven elements (7) jump the legs apart (1) jump through (2) jump through. (1) Jump to urdhava Kukkutasana (1) jumpbing back from padmasana (1) jumping back (2) jumping back from lotus (1) jumping back. jumping through (1) Jumping between standing postures (1) jumping into lotus (1) Jumping out of Bhjupindasana (1) jumping through (2) justification (1) Kandasana (4) Kapalabhati (2) KAPHALASANA (1) KAPHALASANA and BRAHMASANA (1) Kapil Math (1) Kapilasana (1) kapilasana Advanced B (1) Kapilasana. (1) Kapotasana (49) kapotasana ankles (2) Kapotasana Asana most necessary least significant (1) kapotasana heels (1) Kapotasana in india (1) kapotasana long stay (1) Kapotasana progress videos Dec 08 to Present (1) karandavasana (48) Karandavasana progress 14 day challenge (2) Kareem Abdul-Jabar (1) Karen Haberman (1) Kasyapasana (1) Kausthub Desikachar (4) keeping yoga mats clean (1) Keshava Murthy (1) Kevala kumbhaka (1) key asana (2) KHYF (1) KHYF Scandal (1) Kidney stones (5) kidney stones and yoga (1) kindle (1) Kindle paperwhite (1) Kino (11) Kino Advanced A (1) Kino MacGregor (6) Kino trivikramasana (1) knees together kapotasana (1) Knossos (1) Kosha's (1) Kovalam (1) KPJAYI (2) Krama (1) Krishanacharya (2) Krishanamacharya (7) krishanamcharya and the big man (1) Krishmamacharya 2nd (1) krishna (1) Krishnamacharya (136) krishnamacharya 1938 movie (1) Krishnamacharya and Buddhism (1) Krishnamacharya and Burmese Buddhism. (1) Krishnamacharya and tibet (1) Krishnamacharya backbending (1) Krishnamacharya Biography (1) Krishnamacharya chanting (1) Krishnamacharya documentary (1) Krishnamacharya drishti (1) Krishnamacharya hip fracture (1) Krishnamacharya in colour (1) Krishnamacharya in Mysore (1) Krishnamacharya in Tibet (1) Krishnamacharya interview (1) Krishnamacharya jumping (1) Krishnamacharya lost photo (1) Krishnamacharya movie (3) Krishnamacharya on Chakras (1) krishnamacharya original asana (1) krishnamacharya poster (1) krishnamacharya Primary series. (1) Krishnamacharya quotes (1) Krishnamacharya reading list (1) Krishnamacharya resource (1) Krishnamacharya shoulder stands (1) Krishnamacharya teaching. (2) Krishnamacharya video (1) Krishnamacharya workshop in Leon (1) krishnamacharya. (4) Krishnamacharya's 32 headstands (1) Krishnamacharya's Advanced asana (2) Krishnamacharya's Ashtanga Primary series (2) krishnamacharya's Biography (1) Krishnamacharya's certification (1) Krishnamacharya's daughter (1) Krishnamacharya's early Mysore practice. (1) Krishnamacharya's English (1) krishnamacharya's examination (1) Krishnamacharya's guru (1) Krishnamacharya's key asana (1) Krishnamacharya's life saving practice (2) Krishnamacharya's Middle group asana (1) Krishnamacharya's Original Ashtanga Yoga (1) Krishnamacharya's own practice (3) Krishnamacharya's personal practice (1) Krishnamacharya's practice (1) Krishnamacharya's pranayama (2) Krishnamacharya's pranayama practice (1) Krishnamacharya's second series (1) Krishnamacharya's sun salutation (1) krishnamacharya's Yoga Makaranda (1) Krishnamacharya's Yogasanagalu (2) krishnamacharya7s Ashtanga (1) Krishnamcharya (1) Kristina Ireland (3) Kristina Karitinou (7) Kriya (2) Kumbhaka (27) Kumbhaka and healing (1) Kumbhaka breath retention (1) Kumbhaka for healing (1) kumbhaka ha and tha bandhas (1) Kumbhaka in asana (4) kumbhaka jumping (1) kumbhaka. (1) Kumbhakha (1) kurma purana (1) Kurmasana (2) KYM (2) ladies holiday (2) lagu vajrasanam supta vajrasana (1) Lake Biwa (1) Lamrim (1) Lara Abiesheikh (1) laughter yoga (1) Layering images (1) learn dance hand mudras (1) Learn pranayama (1) Learn Pranayama mantra (1) Learn Sanskrit (1) Learn to chant (2) learn to float drums (1) Learn to float primary DVD (1) Learning pranayama (1) learning Sanskrit numbers (1) learning sanskrit yoga names (1) Learning Sanskrit. (1) Learning the pranayama mantra (1) Learning the sanskrit names for Ashtanga primary series. learning the Ashtanga vinyasa count (1) Learning Vinyasa Count (1) led 2nd series (1) led Advanced Ashtanga series. (1) Led Ashtanga primary (1) Led Intermediate series (1) led primary (1) Led second series (1) ledt intermediate (1) Left hand tantric yoga (1) leg behind head (3) Leg behind head preparation postures (5) leg raises (2) legacy of Hippie movement (1) Leon Workshop (1) Les twins (1) less asana (1) levitating (1) life saving practice (1) Life saving Yoga practice (1) Light on yoga (1) Lille (1) lineage (4) Lineage holder (1) lineage Kausthub Desikachar allegations (1) Linking Asana (1) Lino Miele (6) Lino Miele Ashtanga book (1) Lino Miele primary to Advanced book (1) Lino Miele's pranayama sequence. (1) Live stream of primary. (1) long breathing (1) Long Stays in asana (4) long stays. (1) Lori Shepard and Brian Yuen (1) losing practice (1) loss of practice (1) lotus (5) lotus jump back (1) lotus jump through (1) Lotus lifted spun dropped. (1) Lotus no hands (1) lotus sequence (4) lotus subroutines (8) lotus to headstand (5) Louise Ellis (1) lout (1) loving kindness (5) Loving kindness and Yoga Sutras (2) lumbosacral arthritis (1) macrobiotic (3) Madhavan Munusamy (1) Madonna (1) Madonna eka pada sirsasana (1) madonna yoga (1) maha bhandasana (1) maha mudra (1) maha vedha (1) mahabhandasana (1) mahabharata (2) mahamudra (2) Mahavedha (2) Making sushi knife (1) Mala Srivatsan (4) Man of Steel (1) mandala (3) Mandala yoga Bend Usa (1) Manduka (12) manduka bolster (1) Manduka's new Santorini prelate (1) Manju (1) manju jois (27) Manju Jois Bundle (1) Manju Jois TT notes. drishti (1) Manju Pattabhi Jois (2) manju Teacher training (1) Manju TT course Crete (1) Manju TT Crete (1) Manju workshop (1) mantra (1) mantra meditation (2) Manu pranayama (1) Manuel Molina (1) Marcus Aurelius (1) Maria Shalimova (1) Maria Villella (2) Marichiyasana (2) Marichiyasana D (2) Marichiyasana G (1) Marichiyasana H (1) Marichiyasna G (1) marichiyasna H (1) Marie HALLAGER Andersen (2) Marie HALLAGER Anderson (1) Marilyn Monroe (1) Mark and Joanne Darby (1) Mark Darby (7) Mark Darby DVD (1) Mark Robberts (1) Mark Singleton (4) Mark Whitwell (1) Mary taylor. subtle body. (1) Matthew Sweeney (5) Maty Ezraty (3) maya vedha (1) mayaland (1) mayurasana (7) Mcafe (1) Mcafe big macro burger (1) Mea Culpa (1) meaning of asana (1) meaning of yoga (1) meanings of Yoga (1) Meditation (11) Meditative (2) meditative sequence. (1) Meditative subroutines (6) Meghan Currie (1) Melanie Cooper (2) Menstruation (3) mental and emotional abuse against Dr. Kaustaub Desikachar (1) mental Space (1) metta (2) Miami Life center (1) Miley Cyrus (1) Miley Cyrus marichiyasana D (1) Miley Cyrus yoga (1) Mind (1) Mindfulness (1) Mingus (3) minimum asana practice (1) misc primary (6) misc. (22) mitabhashana and mitahara (1) Modern postural yoga (1) modern yoga (1) Modern yoga narrative (1) modern yoga practice (1) modified Ashtanga (3) modified krouchasana (1) modified pasasana (1) Modified practice (1) modified sun salutation. pranayama bolster (1) modifying practice (1) modifying your practice (1) Monkey mind (1) moola bhandasana (1) moolabhandasana (1) moolabhnadha (2) Moon day (2) Moon days (1) More to Mysore (1) morning practice (1) motivation (4) Mountains (1) Mountains of asana (1) Mr T (1) Mr. A.F. Lara Abiesheikh (1) Mrityunjaya mantra tutorial (1) mudra (5) Mudras (2) mula bandha (4) mula bhandasana (1) mulabhandasana (1) mulabhandha (1) Music (1) My book on Kindle (1) My Early Ashtanga movie (1) My Easter Ashtanga retreat (1) my Mysore room (1) My practice (1) My Practice. (1) My very old practice videos (1) My Vinyasa Yoga practice Book. (1) My workshops (3) My year in posts (7) Mysore (3) Mysore dream (1) Mysore in Maidenhead (1) Mysore Magic Yoga At The Source (1) Mysore map (1) Mysore rule change (1) Mysore sandle soap (1) Mysore shala (2) Mysore Yoga Shalas (1) Mysore yoga tradition (1) Mysore? (1) Nada Yoga (1) nagaraya namaha (1) nakrasana (2) namarupa (6) namaskara (1) Nancy Gilgoff (11) natajarasana (1) Natanaga Zhander (1) Nauli (1) Nauli bad for womb? (1) Nauli Kriya (1) navasana to handstand (1) Nespresso (1) Nespresso Pixie (1) NEW BLOG (1) new postures (1) newsletters (40) Nietzsce (1) Nietzsche' (1) Niigata Japan (1) Nike grips (1) Nine bandhas (2) Niralumba sarvangasana (1) niralumba sirsasana (4) niyama (1) No Coffee no prana (1) no hands lotus (1) No merit to speak of (1) No official ashtanga (1) Norfolk Nature reserve (1) Norman Allan (1) norman blair (1) Norman Sjoman (2) Norman Sjoman workshop (1) nostril dominance (1) not about the count (1) Notes to self (7) NYT (1) Object and Objectless Meditation (1) odissi (1) official ashtanga (1) oh my datum (1) OHMME YOGA (2) Old Ashtanga article (1) Old krishnamacharya pictures (1) Old man of hassan (1) old shala (2) old Yoga videos (1) Oleg Flow (1) olympic yoga (1) OM The world of Ashtanga Yogis (1) Omkrasana (1) on blogging (2) on devotion (1) On krishnamacharya (1) On retreats (1) on Series (1) On the meaning of the word yoga (1) on vinyasa (1) on your feet (1) on your feet sequence (1) ondividual ashtanga practice (1) one month chakra bhandasana challenge (2) Only one Ashtanga book (1) opening chant (1) or degenerative joint disease or osteoarthrosis (1) origin of Ashtanga (1) original Ashtanga (3) original ashtanga syllabus (2) Original ashtanga table (1) Original ashtanga vinyasa count (2) original bhagavad gita (1) Original sun salutation (3) original surynamaskara (1) origins of Ashtanga (3) origins of ashtanga. (1) origins of sun salutation (1) Origins of yoga (1) orisgin of Ashtanga (1) Orisginal Ashtanga syllabus (1) Orthodox church (1) Osteoarthritis (1) Osteoarthritis of the spine (1) Outer gazing - Krishnamacharya (1) outtakes (1) overweight (1) oving kindness mantra (1) pachimatanasana (1) Padangustha Dhanurasana (1) Padma mayurasana (1) padmasana (4) painkillers (3) pancha kosha (1) pancha maya (1) paralympics (1) param yoga (1) Paramaguru (2) Paramaguru Sharath R. Jois (1) Paramata (1) parampara (5) Parasarita Padottanasana C (1) Pariṇāma (1) parsva dandasana (2) pasasana (8) paschimottanasana (5) Pashasana (1) pass (1) patanjali (5) patanjali prayers (1) Patanjali's yoga sutras (1) Pattabhi Jois (36) Pattabhi Jois advanced led A (1) Pattabhi jois Advanced series (1) Pattabhi Jois and Patanjali (1) Pattabhi Jois article (1) Pattabhi Jois asana (1) Pattabhi jois asana photos (1) Pattabhi jois handstand (1) pattabhi Jois interview (2) Pattabhi Jois Led (1) Pattabhi Jois resources (1) Pattabhi Jois samastithi (1) Pattabhi jois with Krishnamacharya (1) pattabhi Jois. (2) Pattabhi Jois' pranayama Sequence (1) Pattabhi Jois' Yoga Journal letter (1) Pattabhi joys led primary (1) Paul Gold (1) Paul Harvey (1) peace chants (1) Peg Mulqueen (2) Period (1) Perissa Beach (1) Perter Brooks Mahabharata (1) Pet Cremation (1) Petri Raisanen (2) Petri Räisänen (2) Philippa Asher (2) Philokalia (1) Philosophy (3) Philosophy of Patanjali (1) Phone call (1) phulgenda Sinha (2) Physical Space (1) pinca mayurasana (1) Plagerism (1) Playing flute in asana (1) Pm Modi (1) PM Modi practicing yoga (1) postural yoga practice (1) pottery (1) practice guidelines (1) practice report (1) practicing ashtanga at home (1) practicing together (1) Practicing Vinyasa Krama (1) Practicing with Sharath (1) practicing with short arms (1) practicing Yoga at home (1) practicing yoga when overweight (1) Prana (1) prana shorts (1) prana vashya yoga (1) pranayama (31) Pranayama : Breath of Yoga (1) Pranayama and meditation (1) Pranayama by Pattabhi Jois (1) Pranayama chant (1) Pranayama chanting meditation (12) pranayama in asana (2) pranayama mantra (2) Pranidhi Varshney (1) prasadana (1) Prashant Iyengar (4) Pratyahara (3) Pregnancy (1) Pregnancy and Ashtanga (1) preparation for yoga (1) press to handstand (18) Presse Medicale 1936 (1) primary (2) Primary and 2nd series together (1) primary coming back. (1) primary manual (1) Primary series (1) Primary series book (1) Primary series practice sheets (1) Problems with Ashtanga (3) proficiency in asana (1) Proficient primary (1) progressing through ashtanga series (1) prolite (1) Pungu kukkutasana (2) puraka (1) puraka kumbhaka (1) Purna matsyendrasana (8) Purusha (3) Pushpam (1) Questions from krishnamacharya's students (1) Questions to krishnamacharya (1) Quietude (1) R. Sharath Jois (2) Radha (2) Rainbowman (1) Raja Bhoja (1) raja kapotasana (2) Raja yoga (1) Rajah of Aundh (1) rajakapotasana (1) rajas and tamas (1) ram (1) rama Asana (1) Rama Mohana Brahmacari (1) Rama Mohana Brahmacharya (1) Ramamohana Brahmachari (1) Ramamohana Brahmachari' (1) ramaswam's newsletters vol 1 and vol 2 (1) Ramaswami (43) ramaswami chanting (3) Ramaswami in UK (1) Ramaswami Interview (1) Ramaswami newsletters (33) Ramaswami on Krishnamacharya (1) Ramaswami on meditation. (1) Ramaswami resources (1) Ramaswami teaching (2) ramaswami. (1) Ramaswami's key asana (1) Ramaswami's Newsletters Vol 1-3 for Download (2) Ramaswami's Yoga sutra tutorial (1) Ramaswami's yoga sutras (1) Ramaswamin (1) Reading list (1) recaka kumbhaka (1) recheka (1) recheka kumbhaka (1) Relationships (1) relaxed abdomen mayurasana (1) Religiousness in yoga (1) replacing the mac hard Drive (1) Rethymno (1) Rethymno Ashtanga (1) retread (1) Review (2) reviews (43) Reviews. Kino Macgreggor (1) Richard Freeman (22) richard freeman and Pattabhi Jois (1) Richard Freeman five day intensive (1) Richard Freeman intensive (3) Richard Freeman. (1) Richard Schechner (3) right speech (1) Rilke (1) Rinzai Zen (1) rishi (1) rishi series (4) Rishi Seris (1) Rishi's (1) Rmaswami (1) Robert thurman (1) role models (1) Roots of Yoga (1) runway posters (1) Runway project (1) Ryan Leier (2) Sadhaka: the yoga of B.K.S. Iyengar (1) Sahaj Marg (1) Sahaj Marg Meditation (1) sahanavavati tutorial (1) Saharath (1) Salinger (1) Salutations to the Teacher and the Eternal one (4) Samadhi (1) samakonasana kroukachasana challenge (2) Samaria gorge (1) Samkhya (7) Samkhya krika (1) Samyama (3) Sandhinirmocana Sutra (1) Sanskrit numbers (1) Santorini (4) Saraswati (1) sarvanagasana (6) sarvangasa (3) sarvangasana (5) sarvangasana preparation (1) satvic (1) Satya murthy (1) savasana (1) Śavasana (1) savasana Ashtanga take rest (1) saxophones (1) say (3) sayanasana (1) Sayasana (1) science of pranayama (1) science pertaining to the Self within. adhyātmavidyā (1) seated (2) Seattle Slyer espresso machine. (1) Seductive ashtanga (1) see my (1) sequences and subroutines. (88) Setu Bandhasana and chakra Bandhasana. (1) seven deadlies (1) seven headstands (1) Shadow yoga (1) shakuhachi (1) Shala (3) Shala practice (2) shala trail run (1) Shandor Remete (3) Shang Yen (1) Shanti mantra transcriptions (1) Shanti mantras (1) Sharat (1) Sharath (20) sharath / Jois old Video (1) Sharath Advanced A (1) Sharath conference (2) sharath dwi pada sirsasana (1) Sharath interview (1) Sharath jois (2) Sharath led primary (1) sharath primary DVD (3) Sharath Rangaswamy (1) Sharath Rangaswamy Jois (1) Sharath tour dates (1) Sharath Utkatasana exit (1) Sharath virabhadrasana exit (1) Sharath. (1) Sharath's book (2) Sharath's karandavasana (1) Sharath's led primary at Joisyoga NYC (2) Sharath's new book (1) Sharath's practice. (1) Sharath's pranayama video (1) Sharath's Virabhadrasana video (1) Sharpening japanese knives (1) Shiga (1) Shiga prefecture (1) shirsasana (1) Short Ashtanga practice. (1) shoulder stand (1) shoulder stand vinyasas (3) shoulderstand (6) Shoulderstand variations (1) Shoulderstands. (1) Shri Louise (1) Shribashyam (1) Shubogenzo (1) Sick (1) sick bed practice (1) siddhars (1) siddhis (2) SIKSHA VALLI (1) Silent Illumination (1) simhasana (2) Simon Borg-Oliver (8) Simon Borg-Olivier (5) Simon-Borg Oliver (1) Simple core vinyasa Krama practice (4) Sin salutation with mantras (1) sinha (1) sirsasana (17) Sirsasana variation (1) Sirsasana variations (1) sirsasana. headstand (1) SIRSHASANA (2) Sirssana (1) Sisrasana (1) sitali (1) sitali pranayama (1) sitali suryabheda nadi shodana (1) Sivananda (1) skilful practice (1) SKPJ (1) Skydiver Felix Baumgartner breaks sound barrier (1) Slow Ashtanga (5) Slow Ashtanga Osaka (1) slow sun salutation (1) Slowed down 2nd series (1) Slowed down Primary series (1) sma konasana (1) Soap opera practice (1) Sofia Xirotiri (1) SOHAM (1) Sonia Nelson (1) Soto zen (1) Space (1) Spinal sequence (1) Spiritual life (1) Spiritual practice? Yoga philosophy (1) splits (1) spondylosis. Suryanamascara (1) Sri K Pattabhi Jois (8) Sri K. Pattabhi Jois (3) Sri k. Pattabhi Jois memorial (1) Sri K. Pattabhi Jois' legacy (2) SRI T K SRIBHASHYAM (3) Sri TK Sribhashyam (2) Sri. K. Pattabhi Jois (1) Sribashyam sri sribashyam (1) SRIBHASHYAM (1) Srivatsa Ramaswami (55) Srivatsa Ramaswami Story time (1) Srivatsa ramaswami. (2) Srivatsa Ramaswami's (1) Srivatsan (1) steadiness and comfort ( sthhira and sukha). (1) Stillpoint yoga (3) Stoic (1) stoicism (1) stopping yoga clothes from smelling. (1) Straight leg jump through (10) Straight leg jump through. (1) studying with krishnamacharya (1) Subject/Object (1) Subroutines. (2) Subtle body (2) Summary Yoga sutras (1) Sun salitation variations (1) Sun salutation (5) sun salutation mantras (2) sun salutation to directions. (1) sun salutation with mantra (1) Sun salutation with mantras (2) sun salutation with mantras. Suryanamaskara (1) super moon (1) Superman (1) supine (2) Supine sequence (2) supine Subroutines (18) Supoine (1) supra trivikramasana (1) supta kurmasana (8) supta kurmasana Bhuja Dandasana (1) Supta Vajrasana (8) Suptapada Parsvangushtasana (1) Suptaparsva paddanguthasana (1) Surf guitar medley (1) Surrender (3) sury namaskara with mantras (1) surya namaskar (1) suryanamakara (1) Suryanamakara with mantras (1) Suryanamaskara (2) Suryanamaskara with mantras (1) surynamaskara (1) Surynamaskara practice sheet (2) surynamaskara with mantras (1) Suy namaskara (1) svanasanas (1) Swami Bua (1) Swami Hariharananda Aranya (2) Swara yoga (1) Sweat and kidney stones (1) Sweaty practice (1) T. K. Shribashyam (4) T. K. Sribashyam (1) T. Krishnamacharya (1) T.K. Sribhashyam (2) Table of asana (2) Taboo (1) Taḍagī Mudra (1) tadasana (5) Taittiriya Upanishad (1) TAN postures (1) Tantric Yoga (1) tapas (2) tatakamudra (2) tatkamudra (1) tatkamudra. (1) tattvas samkhya (1) teacher training (1) Teaching (4) Teaching Ashtanga (2) teaching first vinyasa krama Class (1) teaching yoga Adjusting asana (2) ten breaths in each asana (1) ten second inhale (1) Teos Bernard (1) textual support for kumbhaka in asana (1) The 'Original' Ashtanga yoga Syllabus given to Nancy Gilgoff and David Williams by Sri K Pattabhi Jois in 1974 Mysore (2) The Art of Ashtanga vinyasa (1) the asana before the asana (1) The Ashtanga Key (1) The Ashtanga Yoga Center (1) the breath (2) The Breath of Yoga (1) The breathing God (4) The Complete Ashtanga Yoga Syllabus demonstrated by David Williams (2) The Complete Book of Vinyasa Yoga : Subroutines page numbers (1) The Four Immeasurables (1) the Gita as it was (1) The Indian Review (1) The Jesus prayer (1) THE KALAMA SUTRA (1) The Kumar brothers Vijay Kumar (1) The looting of Yoga (1) the Original gita (3) the Original Yoga Sutras (2) The power of Ashtanga yoga (1) The power of Yoga. (1) The practice place (1) The Purnacarya (1) the purpose of yoga postures (1) the purusha sutra (1) the Science of yoga it's risks and rewards (1) The Shala (1) the Source (2) The Spine (3) The Time-Being (1) The Viniyoga letter (1) The vinyasa count (1) The way back (1) The yoga of breath (1) The yoga Podcast (3) thinking of giving up Ashtanga (1) three gunas (3) Three postures (1) tibet (1) tic tac (10) tic tock (9) tick tocks (5) tictac (2) tictac viparita chakrasana (1) Tim Feldmann (1) Tim Miller (9) Tirieng Mukha Eka Pada Paschimattanasana (1) Tirumular Thirumandiram (1) Tiryangamukha ekapada pascimottanasana (1) Titchwell (1) Titibhasana (1) tittibasana (1) tittibhasana (2) TK Shribhsyam (1) TK Sribashyam (1) TKV Desikachar (3) tolasana (1) Tolstoy (1) Tolstoyism (1) Tom Sewell (1) tradition (3) traditional yoga (1) Tranquilo (1) transitions (2) Translate (1) Trataka (1) travel (1) Trayumbakum mantra (1) triangamukha Uttanasana (1) trigger point therapy (1) Trikonasana (1) trying yoga (1) tsunami (1) tucking the tailbone. (1) Tudor-Jones (1) tunas (1) tutorial (1) uddiyana bandha (2) Uddiyana bandha in asana (1) uddiyana kriya (1) uddiyana mudra Kino (1) Uji (1) ujjayi (3) unsupported headstand (1) unsupported headstands (2) Upanishads (2) upavishta konasana (1) Urdhava Dhanurasana (2) urdhva dhanurasana (2) Urdhva Kukkutasana (2) Urdhvamukhasvanasana (2) ushtrasana (1) ustrasana (1) Uthpluthi (1) Utkatasana (1) Utkatasana lift (1) utpluthi (1) uttana mayurasana (1) uttanha Shalabhasana (1) Uttarkashi (1) Utthita Hasta Padangusthasana (1) utthita parsvakonasana (1) Vairagya (1) vajrasana (3) Vajrasana sequence (1) Valencia Krishnamacharya workshop (2) Valencia workshop (1) vamana Rishi (1) varying allegations of sexual (1) vashitasana (1) vatayanasana (2) vatyanasana (1) Vayu (1) Vayu Siddhi (1) vayus (1) Vedanta (1) vedic peace chants (1) Veena (1) Vegetarian (1) vegetarian burger (1) Vegetarian Minestrone (2) Vibrem five finger shoes (1) Vicarious Yoga (1) Vidyas (1) Vinay Kumar (2) Vinya Kumnar (1) Vinyasa (7) Vinyasa count (3) Vinyasa Krama (35) Vinyasa Krama 200HR TT program (4) vinyasa krama and pregnancy (1) Vinyasa Krama backbending. (1) vinyasa krama daily practice (6) Vinyasa Krama headstands (1) Vinyasa Krama Individual Asana sequences (1) Vinyasa Krama lotus sequence (1) Vinyasa Krama Practice Book (2) Vinyasa Krama Practice Manual (1) Vinyasa Krama practice routine (4) Vinyasa Krama practice sheets (3) Vinyasa Krama prayer (1) Vinyasa Krama Sister blog (1) Vinyasa krama slideshows (1) Vinyasa Krama speeded up Ashtanga slowed down (1) Vinyasa Krama supine sequence (1) Vinyasa krama Teacher training (2) vinyasa krama ten day practice routine (1) Vinyasa Krama triangle subroutines (7) vinyasa krama tt course (2) vinyasa krama videos (1) Vinyasa Krama Yoga Osaka (1) Vinyasa Krama yoga Teacher Training program (1) Vinyasa Yoga (1) Vinyasa Yoga for Youth (1) Vinyasa Yoga practice book (1) VINYASA YOGA PRACTICE BOOK 2ND ED. (1) viparita chakrasana (13) viparita dandasana (3) Viparita Salabhasana (4) vipassana (1) vipraita salambhasana (1) Virabhadrasana (1) Virabhadrasana lift (1) Viranchyasana (3) Viranchyasana A (2) Viranchyasana B (1) Virasana (1) Visesha vinyasa (1) Visvamitrasana (1) Vital points (1) VK arm balance series (1) VK Asymmetric seated sequence (8) VK Bow sequence (2) VK Inverted sequence (2) VK Lotus sequence (2) Vk Meditative poses sequence (1) VK On one leg sequence (9) VK On your feet sequence (5) VK Seated Sequence (10) VK supine sequence (5) Vrischikasana (1) Vrschikasana (1) wabi wabi (1) waht is a Mysore room (1) Warrior stance (1) Washer Woman's syndrome (1) Washing yoga clothes (1) washing yoga towels (1) Watching guruji practice (1) waterproof iPad (1) Way of the pilgrim (1) Whast is Mysore style (1) What I believe (1) What is Ashtanga (1) What is Ashtanga really (1) What is yoga (2) What is Yoga to me (1) What's changed in Ashtanga (2) What's in a name (1) What's not wrong with Ashtanga (1) When I'm laid in the Earth. (1) Where to practice yoga (1) Why meditation (1) why rest on moon days (1) wide angle lens (1) Wild Yogi magazine (1) Wildyogi (1) William j Broad (1) willing suspension of disbelief (1) Winnipeg Yoga Shala Canada (1) winter clothing (1) Winter practice (2) Woman and Ashtanga (1) Woman and Yoga (1) Workshop (1) workshop. (1) workshops (1) Wrist pain in Ashtanga (1) Wyatt (2) Wyatt Denney (3) yama (1) yama niyama (5) yamas and niyamas (1) Yamini Murthanna (1) Yamini Muthanna (1) Yoga (4) Yoga Anatomy (1) Yoga and aeging (1) Yoga and modern medicine (1) Yoga and Motherhood (1) Yoga and pregnancy (4) yoga and Spinal health (1) yoga and Sport (1) Yoga and superheros (1) Yoga and the Spine (1) Yoga and weight (1) Yoga and Women (1) Yoga as it was (1) yoga as sport (1) Yoga bibliography (1) yoga bloopers (2) Yoga Body (3) yoga bookshelf (1) Yoga bookshelves (1) Yoga Campus (1) yoga class size (1) Yoga Dandasana (1) Yoga for Diabetes (1) Yoga for joints (1) Yoga for the three stages of life (3) Yoga for women (1) Yoga for youth (1) Yoga Fundamentals course (1) YOGA GLOSSARY (1) Yoga Gurandam (1) Yoga History (1) Yoga in Britain (1) Yoga in post war Britain (1) yoga in schools (1) Yoga in the west (1) Yoga in UK (1) yoga is not antithought (1) Yoga Journal (2) Yoga Korunta (8) yoga korunti (1) Yoga Makaranda (22) Yoga makaranda ( part II) (1) Yoga Makaranda asana (1) Yoga makaranda asana list (1) Yoga Makaranda part 2 (1) Yoga Makaranda Part II (2) Yoga makaranda translation. (1) yoga makaranda. (1) Yoga mala (1) Yoga mat bags (2) Yoga mat bags from recycled Kimono's (1) Yoga matbags from recycled kimono material (1) Yoga Meditation (4) Yoga Mela Kripula (1) Yoga mudra (1) Yoga Nidra (1) yoga of action (1) yoga of motion (1) Yoga of the Yogi (1) Yoga on film (1) Yoga on Santorini (1) Yoga Philosophy (7) Yoga Philosophy of Patanjali (2) Yoga raading list (1) yoga rahasya (1) Yoga Rainbow festival (6) Yoga reading list (1) Yoga Science (1) yoga selfies (1) Yoga sex scandals (1) Yoga shorts review (2) yoga Styles (1) Yoga sutra 1:33 (1) Yoga sutra chanted (1) Yoga Sutras (14) Yoga Sutras II-49 (1) Yoga Sutras in plain English (1) Yoga Sutras transliteration (1) Yoga Taravali (1) yoga taravali chant (1) Yoga teacher training. (1) Yoga Therapy (2) Yoga therapy articles (1) Yoga Therapy for Children with Special Needs (2) Yoga tradition of the Mysore palace (1) Yoga Unveiled (1) Yoga Vasistha (1) Yoga Workshop (1) Yoga Workshop USA (1) Yoga yajnavalkya (1) Yoga Zagreb Croatia (1) Yoga: Tradition in the Eyes of Modernity (1) yoga's loss of meaning (1) Yoga's loss of purpose (1) Yoga=Addiction? (1) Yogacarya Krishnamacharya - The Purnacarya (2) Yogacarya Krishnamacharya - The Purnacarya. Edited by Mala (1) YogaGlo (1) Yogakriyas (1) Yogamatters (2) Yoganidrasana (1) Yogāsana-Jaina (1) Yogasanagalu (44) Yogasanagalu asana list (1) yogasanagalu translation (5) Yogasanagalu. (1) Yogasanagalua (1) Yogasynergy (1) Yogavataranam (1) Yogayajnavalkya (1) Yogeshwara Ramamohana Brahmachari (1) Youtube videos (1) YS I:14 (1) Yurt Norfolk camping (1) Yvonne Millerand (2) Yyvonne milerand (1) Zen Bones. Centering practice (1) zen circles (1) Zen Flesh (1) Zen training (1) Zoë Slatoff-Ponté (1)

A Reminder

from Kalama sutra, translation from the Pali by Bhikkhu Bodhi This blog included.

"So, as I said, Kalamas: 'Don't go by reports, by legends, by traditions, by scripture, by logical conjecture, by inference, by analogies, by agreement through pondering views, by probability, or by the thought, "This contemplative is our teacher." When you know for yourselves that, "These qualities are unskillful; these qualities are blameworthy; these qualities are criticized by the wise; these qualities, when adopted & carried out, lead to harm & to suffering" — then you should abandon them.' Thus was it said. And in reference to this was it said.

"Now, Kalamas, don't go by reports, by legends, by traditions, by scripture, by logical conjecture, by inference, by analogies, by agreement through pondering views, by probability, or by the thought, 'This contemplative is our teacher.' When you know for yourselves that, 'These qualities are skillful; these qualities are blameless; these qualities are praised by the wise; these qualities, when adopted & carried out, lead to welfare & to happiness' — then you should enter & remain in them. Buddha - Kalama Sutta
Creative Commons License
Ashtanga Vinyasa yoga at home by Anthony Grim Hall is licensed under a Creative Commons Attribution 3.0 Unported License.
Permissions beyond the scope of this license may be available at http://grimmly2007.blogspot.co.uk/.