The Blog title poster above forms part of a series of posters I made up for a book, 'Krishnamacharya's original Ashtanga Yoga', based on the public domain translation from the Tamil edition of Krishnamacharya's Yoga Makaranda (Mysore 1934) . It's available for free on my Free Downloads page above. There is a print edition on ( Note: It's best to buy it in print from Lulu as I can reduce the price down almost to cost rather than on Amazon where I have less control of pricing.

Saturday, 12 May 2012

More Yogasanagalu translation; Final page of first section.

See the ongoing Yogasangalu translation project for the translation so far.

Below is the final page of the first section and directly follows the asana table from yesterday.


Vinayasas” many people are curious about its secret.  Some others want to know its basis.  I agree.



By making the breath smooth (and long), and by concentration or focussing the mind on the breath, the perfection of the posture is obtained
Please see Patanjala yogasutra and Vyasabhasha (P 2, S 47) *and my notes below

Both type of people (practitioners), be happy (enjoy).

Vachaspathi Mitra in that commentary

“सांसिद्धिकोहिप्रयत्न​ः शरीरधारको न योगांगस्योपदेश्टव्यासनस्य कारनम्।  तस्मात् उपदेश्टव्यासनस्यायमसाधकः विरोधीच स्वाभाविकः प्रयत्नः। तस्य च याध्रुच्छिकासनहेतुतया सननियमोपहंत्यत्वात्॥”

“Saamsiddhiko hi prayatnah shariradharako na yogangasyopadeshtavyasanasya kaaranam.  Tasmat upadeshtavyasanasyayamashadhakah virodhi cha swabhavikah prayatnah.  Tasya cha yadruchhikasanahetutayaa sananiyamopahamtyatvat.”

“तसात् उपधिश्टनियमासनम् अभ्यस्यता स्वाभाविकप्रयत्नशैथिल्यात्मा प्रयत्न अस्तेयः नान्यथा उपदिश्टं आसनं सिध्यतीति स्वाभाविकप्रयत्नशैथिल्यं आसनसिद्धिहेतुः।”

“tasmat upadishtaniyamaasanam abhyasyataa svaabhaavikaprayatnashaithilyaatmaa prayatna asteyah naanyatha upadishtam asnam sidhyateeti svaabhavikaprayatnashaithilyam asanasiddhihetuh”

“अनन्ते व्या-नागनायके स्थिरतरपणासहस्रविध्रुतविश्वंबरामंढले समापन्नं चित्तं आसनं निर्वर्तयतीति”

“Anante vya-naganayake sthiratarapanasahasravidhrutavishwambaramandale samapannam chittam asanam nirvartayateeti” *see my notes below for translation

Therefore, how many breathings for which asana?  When is inhalation?  When is exhalation? In what way? When body is stretched forward, inhalation or exhalation? What about when you raise your head? To know this mystery and practice in order is called Vinayasa.  These along with the significance of each asana will be discussed in 1 to 32.  


*The translation and treatment of the sutra below is from Patanjali's Yoga Sutras Based on the teaching of Srivatsa Ramaswami by Pamela Hoxsey and taught on the Vinyasa Krama teacher training course that I attended in 2010. This is relevant because Ramaswami spent over thirty years, from the 1950's to the 1980's, as Krishnamacharya's student.

Yoga Sutra II-47 


"prayatna - effort (of life which is breathing)

saithilya - smooth (make it smooth)


          ananta -breath

          samapattibhyam - focusing on it

By making the breath smooth (and long), and by concentration or focussing the mind on the breath, the perfection of the posture is obtained. Note: Krishnamacharya interprets this sutra differently than other teachers. he gives the correct technical meaning (in this context) fromn prayatna or Jivana prayatna, or effort of life which is breath. he says that it is the breath that should be made smooth and effortless, not the posture. it is not physical; it is the breathing" p55
------------------------------- I also found an Online edition of The Yoga Sutras with Vyasa's commentary and the explanation/gloss called tattva- vaicardi of Vachaspati Micra ( Mitra) quoted in length in by Krishnamacharya in the text above.

II- 47. By relaxation of effort or by a [mental] state-of-balance with reference to Ananta [A posture] results. With these words the sentence is completed. When efforts cease the posture is completed,so that there is no agitation of the body. Or the mind-stuff comes into a balanced-state with reference to Ananta and produces the posture. (Vyasa) Having stated what the postures are, he tells what are the means of attaining them. 47.By relaxation of effort or by a [mental] state-of-balance with reference to Ananta. A natural effort sustaining the body is not the cause of this kind of posture which is to be taught as an aid to yoga. For if its cause were such, the preaching of it would be purposeless in that it could be naturally perfected. Therefore this natural effort does not accomplish this kind of posture which is to be taught and is contrary [to it]. For in so far as this [natural posture] is the cause of an arbitrarily chosen posture it is the destroyer of the specific kind of posture. Consequently a man, practising the specific posture as taught, should resort to an effort which consists in the relaxation of the natural effort. Otherwise the posture taught cannot be accomplished. Or . . . with Ananta,^ the Chief of Serpents, who upholds the globe of the earth upon his thousand very steadfast hoods, [with him] the mind-stuff comes into a balanced state and produces the posture". (Vachaspati Micra) 
Translation: James Haughton Woods The Yoga Sutras of Patanjal

Note on the above translation by Srivatsa Ramaswami

The translation of Vachaspati Misra's work by the English translator the translation of the phrase sariradharaka is imprecise. I am supplying the appropriate terms I deem correct.

1. "By relaxation of effort sariradharakah

A(The) natural(innate) effort sustaining the body ( sariradharakah=that which sustains the body, breath) is not the cause of this kind of posture which is to be taught as an aid to yoga (That is, normal breathing is not the cause of attaining the yoga posture). For if its cause were such, the preaching of it (mentioning of sariradharaka or breath) would be purposeless in that it(posture) could be naturally perfected. Therefore this natural effort ( normal breathing)does not accomplish this kind of posture which is to be taught and is contrary [to it]. For in so far as this [natural posture](nay, normal breathing) is the cause of an arbitrarily chosen posture it is the destroyer of the specific kind of posture. Consequently a man, practising the specific posture as taught, should resort to an effort(prayatna) which consists in the relaxation of the natural effort (breath). Otherwise the posture taught cannot be accomplished". Vachaspati Micra

2. You could also see that without translating the above Vacaspati Misra's commentary Sri Krishnamacharya goes extensively to talk about breathing in asanas and vinyasas immediately thereafter as quoted by you in your postings on Yogasanangalu. I could say with a certain amount of assurance, fortified by a long studentship that Sri Krishnamacharya taught Yogasanas with synchronized breathing. He has quoted from texts like Yogasutras and commentaries like Misra's and also Navyas Nyaya a sibling philosophy. I would request you to also have a look at the last couple of paragraphs of my article on Krishnamacharya published by Namarupa. I am afraid the English translation you have quoted is more an academic work by Sanskrit scholar and not by a Yogi as Sri Krishnamacharya.

"Going back to my notes on Yoga Sâtra classes with my guru, I found a very interesting interpretation of the sâtra, Prayatna-ùaithilya anantasamápattibhyám. The word prayatna, very commonly used in India, basically means “effort.” úaithilya indicates “softness.” So Prayatna- ùaithilya could mean “mild effort”; hence you find that many writers on the Yoga Sâtras declare that the way to achieve perfection in a yoga posture is to “ease into the posture effortlessly.” This is easier said than done. There are hundreds of practitioners who cannot relax enough to be able to easily get into a posture like the Lotus, for example. So we have to investigate the meaning of the word prayatna as used by the darùanakáras in those days. Prayatna according to Nyáya, a sibling philosophy to yoga, is a bit involved. Nyáya explains prayatna of three kinds (prayatnaê trividhaê proktam). Two of them are the effort put in for happiness (pravätti) and the effort to remove unhappiness (nivätti). Every being does this all the time. One set of our efforts is always directed toward achieving happiness and the other toward eradicating unhappiness. But the third type of effort relevant here is the effort of life (jàvana-prayatna). What is effort of life? It is the breath or breathing. Now we can say that prayatna-ùaithilya is to make the breath smooth. Thus in ásana practice according to Vinyása Krama, the breath should be smooth and by implication long (dàrgha).
The other part of the sâtra refers to samápatti, or mental focus. Where or on what should the mental focus be? It is to be on ananta (ananta-samápatti). Now we have to investigate the contextual meaning of the word ananta, translated as “endless” or “limitless,” which many writers equate with infinity. So some schools tend to say that while practicing ásanas, one should focus the attention on infinity, which is inappropriate— and impossible, at least for the vast majority of yogàs. Ananta also refers to the serpent, Ädiùeüa, whose incarnation Patañjali is believed to be. So some schools suggest that one should focus on a mental image of Ädiùeüa or Patañjali. It may be possible, but it is uncomfortable to think that Patañjali would write that one should focus on his form for the success of ásana practice. So what might ananta symbolically signify? The word ananta can be considered to be derived from the root, “ana”—to breathe (ana ùváse). We are all familiar with the group of words práóa, apána, vyána, etc., names of the five práóas derived from the root “ana.” So in the sâtra, ananta could mean “breath”; ananta-samápatti is then translated as “focusing the mind on the breath.” In fact Ananta, or the serpent king, is associated with air. Mythologically the cobra is associated with air; there is a common mythological belief that cobras live on air. If you look at the icon of Naôarája (the dancing úiva), you will find all five elements of the universe (earth, water, air, fire, and space) represented symbolically in úiva. The matted red hair represents fire, the Gaïgá in his tresses, the water element; the air element is said to be represented by the snake around the lord’s neck. So ananta-samápatti would mean focusing the attention on the breath or práóa.
Thus this sâtra means that while practicing ásana, one should do smooth inhalations and exhalations and focus the attention on the breath. Since Vinyása Krama involves several aesthetic movements into and within yoga postures, to achieve the coordination of movement, breath, and mind, one should synchronize the breath with the movement with the help of the focused mind. By such practice, slowly but surely, the union of mind and body takes place, with the breath acting as the harness. But why don’t other texts talk about it? There is a saying, “Anuktam anyato gráhyam.” If some details are missing from one text, they should be gathered from other complementary texts. Haôha-yoga-pradàpiká explains a number of ásanas but does not mention breath synchronization and other basic parameters. But Haôha-yoga-pradàpiká proclaims that its instructions are like a prerequisite for the Rája Yoga practice of Patañjali. These two texts are therefore compatible. Thus we can conclude that Patañjali gives the basic parameters of ásana practice (and also of the other aïgas like Práóáyáma), but for details we have to refer to compatible texts like Haôha-yoga-pradàpiká, Yoga- Yájñavalkya and others".

Translation of Ananta
Ananta is another name for Vishnu (the infinite. limitless one) and often gets translated as infinity, some argue that the meaning of this sutra is to meditate upon the infinite, Sankara puts it like this,

"When the mind attains samadhi on that which stands pervading all existence, the posture is perfected, made firm" p275  

As Ramaswami states
"Krishnamacharya interprets this sutra differently than other teachers..."

"There is another interpretation of the word ananta. The...meaning comes from the word "ana" which means to breathe. Ana means preach. for example, prana, apana, vyana, and so on. They all come from the root ana, to breath. So, here ananta refers to the breath. Ananta Samapatti is to focus your attention on the breath. Anatasamapatti is to focus your attention on the life force which is the breath." p97-98

Both type of people (practitioners), be happy (enjoy). ?

I've been troubled by the meaning of this, it seems to be a heading but what are the two types Krishnamacharya is referring too. 

In the quoted (at length) commentary of Vachaspati Micra we find this line,

"By relaxation of effort or by a [mental] state-of-balance with reference to Ananta"

Is this then the two types (approaches to practice or asana)  that Krishnamacharya is referring too

1. "By relaxation of effort 
A natural effort sustaining the body is not the cause of this kind of posture which is to be taught as an aid to yoga. For if its cause were such, the preaching of it would be purposeless in that it could be naturally perfected. Therefore this natural effort does not accomplish this kind of posture which is to be taught and is contrary [to it]. For in so far as this [natural posture] is the cause of an arbitrarily chosen posture it is the destroyer of the specific kind of posture. Consequently a man, practising the specific posture as taught, should resort to an effort which consists in the relaxation of the natural effort. Otherwise the posture taught cannot be accomplished". Vachaspati Micra

How do we do this?
As Ramaswami stated above
"By making the breath smooth (and long), and by concentration or focussing the mind on the breath, the perfection of the posture is obtained. Note: Krishnamacharya interprets this sutra differently than other teachers. he gives the correct technical meaning (in this context) fromn prayatna or Jivana prayatna, or effort of life which is breath. he says that it is the breath that should be made smooth and effortless, not the posture. it is not physical; it is the breathing" p55

2. by a [mental] state-of-balance with reference to Ananta
Or . . . with Ananta,^ the Chief of Serpents, who upholds the globe of the earth upon his thousand very steadfast hoods, [with him] the mind-stuff comes into a balanced state and produces the posture". (Vachaspati Micra)


  1. Hi Grimmly,

    On taking a more closer look at that sentence (Enjoy the two types), I want to clarify a little bit more. It seems I missed a single letter that can change the meaning slightly. The more accurate translation should be " Both type of people, be happy (enjoy)". K seems to be addressing two type of practitioners.


  2. Thanks Satya, have changed it in the post. I've added Ramaswami's translation of the sutra and commentary with his notes on Krishnamacharya's interpretation in the notes.

  3. love this zeroing in on the vinyasa definition! gotta get to practice now!




!0 ways ashtanga changed. (1) . Richard freeman Workshop (1) ((% includes theory (1) (OA) (1) ‪#‎proficientprimaryproject‬ (4) %Arabica (1) < manju (1) 10 point way to health (1) 10 second exhalation (2) 10 second inhalation (3) 10 second inhale (1) 10-15 second inhalation/ exhalation (1) 100 years of beatitude (1) 1008 (1) 108 dropbacks (1) 108 dropbacks. (1) 108 sun salutations (1) 17 meanings of yoga (1) 2000 asana (1) 21 Things to know before starting an ashtanga practice (1) 21st century yoga (1) 2nd series (4) 2nd series headstands (1) 2nd series list (1) 3rd edition Vinyasa Krama Practice Book (2) 3rd series (18) 4th series (4) 5% theory (1) 7 deadlies. (1) 80 rounds Pranayama (1) 84 key asana (1) 95% practice (1) 99%practice 1% theory (1) A. G. Mohan (2) A.G. Mohhan (1) Abernathy butter (1) aches and pains (1) Achieving full lotus. (1) acro yoga (1) active movement (1) Acupuncture (1) adhomukha padmasana (1) adhomukha svanasanas (1) Adi Shankara (1) Adjusting (3) Adjusting postures. (1) Adjustments (1) Adjustments/assists (1) Advaita (1) Advanced A (6) Advanced A B C D list (1) Advanced Ashtanga (2) Advanced Ashtanga demonstration (1) Advanced Ashtanga. Advanced asana (1) advanced B (3) Advanced backbending (1) advanced series (2) Advanced series ashtanga (1) Advanced series in primary and Intermediate (1) Advanced standing sequence (1) AG Mohan (4) Ahtanga (1) Ajaan Lee (1) Ajay Tokas (1) Ākāśa (1) Al-Biruni' Yoga Sutras (1) Alessandro Sigismondi (1) Alex Medin (2) Alica Jones (1) alignment (1) alternate breathing in ashtanga (1) Alternative to sun salutation (1) alternative to upward facing dog. practicing with wrist problem (1) alternatives to asana (1) alternatives to headstand (1) Amanda Manfredi (2) Anandavalli (1) Angela Jamison (5) Anjeneyasana Sequence (1) Anne Nuotio (1) ansura (1) Ante-natel Yoga (3) Antenatal Vinyasa krama (1) Antenatal yoga (1) Anthar Kumbhakam (1) Antharanga Sadhana (1) any benefits to advanced asana (1) aparigraha (1) Aparokshanubhuti (1) applied anatomy and physiology of yoga (1) April fool. (1) Aranya (1) Ardha baddha padma eka pada raja kapotasana (1) Ardha Baddha Padma Paschimattanasana (1) ardha matsyendrasana (1) Ardhomukhasvanasana (1) Ariadne's thread (1) arm balances (4) arthritis (1) Aruna Elentari (1) asana (1) Asana and ageing (1) asana and sweat (1) asana as gesture (1) asana as mudra (2) asana lists (1) Asana madness (3) Ashmolean Museum of Art and Archaeology (1) Ashtanga (25) Ashtanga 2nd series (1) Ashtanga 3rd (1) Ashtanga 3rd series (1) Ashtanga 4th series. (1) Ashtanga 6th series (1) Ashtanga A (1) Ashtanga adjustments (2) Ashtanga Advanced A (2) Ashtanga Advanced series (1) Ashtanga Advanced series. Pattabhi Jois (1) Ashtanga and addiction (1) ashtanga and age (2) ashtanga and ageing (3) Ashtanga and Boredom (1) Ashtanga and Diet (1) Ashtanga and Drug Addiction (1) Ashtanga and eating (1) Ashtanga and fun (1) Ashtanga and kumbhaka (1) Ashtanga and losing weight (1) Ashtanga and menstruation (1) Ashtanga and motherhood (1) Ashtanga and pregnancy (1) Ashtanga and recovery (1) Ashtanga and Socrates (1) Ashtanga and Sweat (1) Ashtanga and the wrist (1) Ashtanga and Vinyasa krama yoga Maidenhead (1) Ashtanga and Weight lost (1) Ashtanga and Zen (2) Ashtanga as it was (2) Ashtanga assists (1) Ashtanga assists. (1) ashtanga authorisation (1) Ashtanga B (1) ashtanga backbends (1) ashtanga backbernding (1) Ashtanga books (3) Ashtanga breathing (1) Ashtanga C (1) Ashtanga certification (1) Ashtanga changes (1) Ashtanga cheat sheets (1) ashtanga class size (1) Ashtanga Comparison (1) Ashtanga conference (1) Ashtanga demo (1) Ashtanga demonstration (1) Ashtanga differences (1) Ashtanga dispatch (1) Ashtanga DVD's (1) Ashtanga finishing sequence (1) Ashtanga for beginners (1) Ashtanga history (9) Ashtanga history. (1) Ashtanga illustrations (1) Ashtanga in Europe (1) Ashtanga in Greece (3) Ashtanga in midlife (1) Ashtanga in Mysore (1) Ashtanga in Osaka (1) Ashtanga in the 80s (1) Ashtanga interviews (1) Ashtanga Japan (1) Ashtanga jump back (1) Ashtanga Ladies holiday (1) Ashtanga led (1) ashtanga legitimacy (2) Ashtanga lineage (3) Ashtanga Maidenhead (1) Ashtanga Moscow (1) Ashtanga nothing to fear. (1) Ashtanga Parampara (6) Ashtanga practice (1) Ashtanga pranayama sequence (1) Ashtanga pranayama. (1) Ashtanga primary (2) Ashtanga primary series list (1) Ashtanga primary to advanced series (1) Ashtanga reading list (1) Ashtanga Rishi approach. (10) Ashtanga roots in yoga makaranda (1) Ashtanga Saadhana (1) Ashtanga source (1) Ashtanga syllabus (1) Ashtanga talk through (1) Ashtanga teacher Authorisation (1) Ashtanga terminology (1) Ashtanga tradition (1) Ashtanga TV spot (1) Ashtanga TVAM (1) Ashtanga underwater (1) Ashtanga videos (1) Ashtanga vinyasa (3) ashtanga vinyasa count. (1) Ashtanga Vinyasa Krama (35) Ashtanga Viswanath (1) Ashtanga while on period (1) Ashtanga Yoga (1) Ashtanga Yoga Anusthana (2) Ashtanga yoga Bali (1) ashtanga yoga confluence (6) Ashtanga yoga Confluence Eddie Stern (1) Ashtanga yoga greece (1) Ashtanga Yoga in the tradition of Sri K Pattabhi Jois (1) Ashtanga yoga london (1) Ashtanga yoga manual (1) Ashtanga yoga Moscow (1) Ashtanga Yoga Peru (1) Ashtanga Yoga School Moscow (3) Ashtanga young boys (1) article links (1) Ashtanga's origins (1) Ashtangaparampara (1) Ashtangi interviews (1) Assisting (3) assists (1) astanga (1) Aṣṭāṅga (1) Astanga Yoga Anusthana (1) Aṣṭāṅga Yoga Anuṣṭhāna (1) Astavakrasana (1) asymm (1) Asymmetric (1) Asymmetric asana (1) asymmetric sequence (1) Atma Suddhi mantras tutorial (1) Authorisation (1) AVIDYA (1) AVKY at Home (1) AY:A2 (1) ayc (5) AYC Videos (2) B.N.S. Iyengar (1) B&W yoga videos (1) back bending (3) back bending back bending (1) back bending. (1) back pain (4) back pain lumber region (1) back pain. floating (1) Back problem (1) backbend (1) backbending (8) backbending exercises (1) Backbending prep (1) backbends (4) backbends / dropbacks (73) baddha konasana (4) baddha padmasana (2) badha matsyendrasana (1) badha padmasana (1) Bahauddin Dagar (1) Bakasana (6) balance (1) Bali conference (1) Bandhas (14) bansuri (1) Bansuri Holliger (t)air(e) for solo flute (1) Basti. Neti (1) Beginner Ashtanga (1) beginner yoga reading list (1) Beginning Ashtanga (2) beginning Vinyasa krama (1) beginning vinyasa yoga (1) beginning yoga (2) Being in the World (3) being stopped at a posture (1) benefits of advanced asana (1) best Ashtanga books. (1) best Coffee in Japan (1) Best Coffee in Kyoto (1) best jump back (1) best jump through (1) bhagavad gita (7) Bhagavadagita (2) Bhagavan Das (2) Bharadvajrasana (3) Bharadvajrasana long stay (1) Bharatanatyam (2) Bhaya Kumbakam (1) Bhoja's commentary on Yoga sutras (1) bhuja pindasana (1) Big people can do you (1) Bikram (2) bikram yoga (1) biography of Krishnamacharya (1) Birdwatching (1) Birth & Motherhood (1) birthday (1) BKS Iyengar (3) Bliss (1) blog to book (1) Blogbooker (1) Blogsy (1) BNS Iyengar (3) Body clock (1) Body image (1) Bohr effect (1) Book review (3) Born again Ashtangi (1) bow (1) Bow sequence (9) BRAHMASANA (1) breath (2) Breath control (1) breath holding (1) breath is nice (1) Breath of god (1) Breath of gods (1) Breath of the Gods (3) Breath of the Gods – A Journey to the Origins of Modern Yoga (1) breath retention in asana (1) Breathing (2) breathing asana (1) breathing in Ashtanga (1) breathing less (1) breathing rate in ashtanga (1) British Yoga in the 1950`s and 60`s (1) Bruce lee (1) Bruges (1) Buddhasana (3) Budokan yoga (1) Burmese buddhism (1) cakra (2) Camel walk (3) Carbon Monoxide poisoning (1) Casa vinyasa (1) caturanga Dandasana (1) cave (1) chakea (1) Chakorasana (1) chakra (2) chakra bandhasana (4) Chakra meditation (1) Chakras (3) chakrasana (6) championship yoga (1) Chan meditation (1) Changes (1) Chanting (9) chanting in asana (1) Chanting the yoga sutras. (1) chanting yoga sutras (2) chatauranga dandasana (2) chaturanga (1) Chinese medicine and Ashtanga (1) chitta vritti (1) Chittavijana of Yogasanas (1) choosing an Ashtanga book (1) Christian yoga (1) Christmas practice. (2) chuck Miller (7) CIRCULO BLANCO (1) cit (1) cittavritti (1) classical yoga (1) Claudia and James Kripalu workshop (1) Cley (1) Clifford Sweatte (1) Coleridge (1) Coltrane (1) coming up (1) Common yoga protocol (2) comparison of drishti (1) concentration practice (1) conference notes (1) Conference notes. (1) Consciousness (1) Contemplation (2) Contemplative Sciences Centre (1) Contemplative Studies department (1) Contemporary yoga Culture (1) cooking (1) Creative Commons (1) Crete (2) cultivate (1) current practice (3) cybershala (1) Daily routine of a yogabhyasi (1) Dandasana (1) Danny Paradise (3) Dasha diirgha rechaka puuraka (1) David Garrigues (7) David Garrigues Intermediate DVD (1) David Keil (2) David Robson (5) David Robson's learn to float drums. (1) David Roche (1) David Swenson (7) David Williams (5) Dearbhla Kelly (1) Debbie Mills (1) dedicated practice (1) deep backbends (1) Deepdale Camping (1) defence of Ashtanga (1) degenerative arthritis (1) deindividuation (1) Deleting a blog (1) Dena Kingsberg (2) Der Atmande Gott (1) Der Atmende gott (2) Derek Ireland (13) Desikachar (1) desk pose (1) Detox (3) developing a Home practice (42) Development of Ashtanga series (1) devotion (1) devotion to practice (1) dhanurasana (2) Dharana (6) Dhāraṇā (2) Dharana focal points (1) Dhouti (1) Dhouti kriya (1) Dhyana (3) Did Krishnamacharya speak English (1) Dido and Aeneas (1) Dido's lament (1) die (1) diet (3) Differences in Ahstanga (1) Ding namaskara (1) discernment (1) discipline (6) Dmitry Baryshnikov (1) Do we need an Advanced series (1) does sweating detox (1) downward dog (1) Dr N Sjoman (1) Dr Norman Sjoman (1) Dr. Norman Sjoman (1) dream (1) Drisht (1) drishti (7) dropback (1) dropback prep (1) Dropback progress videos Aug 08 to Present (1) dropback ritual (1) dropback routine (1) dropbacks (1) dropping back (2) Duhkha (1) Durvasana (1) dwi pada sirasana (1) dwi pada sirsasana (2) Dwipada Sirsasana (1) dwipadapitam (2) dwipadasirsasana (1) early asana diploma course (1) Early Ashtanga (1) early ashtanga vinyasa (1) Early Ashtanga yoga article (1) Early pattabhi jois (1) Easter Krishnamacharya retreat (2) Eddie and Jocelyn Stern (1) Eddie Stern (6) effulgence (2) Egyptian backbend picture (1) Eihei Dogen (1) Eiko Saito (1) Eka pada chakra bandhasana (1) Eka pada raja Kapotasana (2) eka pada series (11) eka pada sirsasana (2) eka para baddha padmasana (1) EKAPADA VIPARITAKARANI (1) elephant jornal (1) Emergence du Yoga (1) Emergence of Yoga (5) Emurgence du Yoga (1) Encinitas (1) Encinitas yoga in schools debate (1) Equinox (1) errors in current ashtanga practice (1) Evening practice (2) evening practice. (1) Evolution of Ashtanga (2) Evolution of Ashtanga yoga (1) extended stays (2) extended stays in asana (1) Facebook (1) falling (1) FAT PEOPLE CAN'T DO YOGA? Fat people Can do Yoga (1) Father Joe Pereira (2) feet together dropback (1) feetup (1) femurs (1) First led Ashtanga class ever (1) First practice of 2012 (1) five koshas (1) five sheaths (1) Flexibility in Ashtanga (1) Flexibility within Ashtanga (1) float to handstand (1) floods (1) flotation tank yoga (1) flute (1) Forest tradition (1) formal savasana (1) four Immeasurable and yoga (1) four Immeasurable and yoga sutras (1) four immeasurables (1) four key asana (1) franney and Zooey (1) full vinyasa (6) Functional Anatomy (1) Fusion magazine tribute (1) Ganda Bherundasana (2) Gandha bhandasana (1) Gandha Bherundasana (2) Ganeseha prayer (1) Ganesh Mohan (1) Ganesha prayer (2) Garbha Pindasana (6) gayatri (1) Gayatri chant (2) gayatri japam (1) Georg Feuerstein (1) getting in to full lotus (1) Gil Frondsal (1) Gingi Lee (2) gita as it was (1) Grechikha (1) green smoothie (1) green smoothies (1) Gregor Maehle (12) grimmly's retreat (1) grimmly's workshop (1) Grimmplys Vinyasa Krama Practice Book (1) Guest Vinyasa krama practice (2) Gunas (2) Guru on the Grounds (1) Guru to Go (1) Guru's of Modern Yoga (1) guruji (9) Guruji asana (1) Guruji asana photos (1) Guruji in Copenhagen (1) Guruji London 2002 (1) Guruji London tour 2002 (1) Guruji peforming puja (1) Guy Donahaye (2) Gymnast wrist (1) halasana (1) Half Ashtanga series (1) Halogen heater (1) Hamish Hendry (2) Hampton Court (1) hands free lotus (3) Handstand (1) handstand drop over (1) handstands (3) hanumanasana (8) Harvard Healthy eating plate (1) has yoga evolved (1) hatha and Raja yoga (1) hatha yoga (2) Hatha Yoga Pradipka (1) Hatha yoga pradipka. Aranya (1) headstand (20) headstand prop (1) headstand variations (1) headstand variations. (1) headstands (2) healing through bandhas (1) healing through Kumbhaka (1) Health healing and Beyond (1) heart of the practice (1) heart stopping (1) heart stopping experiment (1) Heartfulness meditation (1) Heartfulness meditation and ashtanga vinyasa yoga (1) Heather Morton (3) Heidegger (3) Heidegger and Yoga (1) Hesychasm (2) hesychast method (1) hidden asana (1) hidden postures between postures. (1) Hippies (1) Hippy (1) History of Asana (1) History of Ashtanga (4) history of Yoga (1) Holderlin (1) holding somebody back in ashtanga (1) holding the breath in asana (1) Holiday (1) Holiday practice (3) home ashtanga practice (1) Home practice (6) home practice. (1) home shala (1) home v shala practice. (1) Home yoga practice (1) hot yoga (1) House recommendations (2) How Ashtanga changed (1) How I met Guruji (1) How mauch to become and Ashtanga teacher (1) How old is Ashtanga Vinyasa (1) How old is Ashtanga? (1) how to breath in asana (1) how to chant the yoga sutras (1) How to do a headstand (3) how to do lotus (1) how to get into lotus (1) how to handstand (1) How to learn pranayama (1) how to meditate (1) How to practice Vinyasa krama (3) Hyon Gak Sunim (2) i Dhyana (1) ideal Mysore self practice room. (1) II-47 (1) Illnes (1) Ilya Zhuralev (1) Improvisation (1) in defence of ashtanga (2) in defense of asana (1) India (2) Indian cosmology (3) Indian dance (1) Indian evolution (3) Indian measurement (1) Indian music (1) Indian physical culture (1) Indra Devi (2) injuries (10) injury (8) Inner gazing (1) Inside an Imac (1) Intermediate (63) Intermediate series (1) internal drishti (2) International Yoga Day (1) Interviews (2) introduction to Ashtanga (1) Introduction to breath control (1) introduction to Vinyasa krama (1) introduction to yoga (1) inversions (7) inverted sequence (6) inverted subroutines (9) Invertions. (1) invocation (1) ipod (1) Is Ashtanga a fixed sequence (1) IS Ashtanga a spiritual practice? (1) Is Ashtanga designed for young boys (1) Is Ashtanga hard (1) Is Ashtanga Hatha yoga? (2) Is it still Ashtanga (1) Is yoga Indian (1) Ishvara gita (1) Ishvarapranidhana (1) iyengar (8) Iyengar Drop back challenge (6) Iyengar jumping (1) Iyengar practicing ashtanga (1) Iyengar yoga (1) Iyengar. 1938 Krishnamacharya movie (3) Iyengar's ashtanga (1) Iyengar's Library (1) jain yoga (1) jalandhara bandha (3) janu sirsasana (3) Japa mantra (2) jar (1) Jessica Walden (5) Jesus prayer (1) jim through (1) Jivatma (1) Joanne Darby (1) Joey Mills (1) John cage (1) John Campbell (1) john Scott (8) John Scott workshop (1) John Scott's Ashtanga App. (1) Jois (1) Jois led intermediate (1) Jois led primary (1) Jois Yoga (1) JoisYoga (1) jump back (1) Jump back jump through (59) Jump back library (1) Jump back monthly progress videos Feb 08 to present (1) Jump back Screenshots (5) jump back seven elements (7) jump the legs apart (1) jump through (2) jump through. (1) Jump to urdhava Kukkutasana (1) jumpbing back from padmasana (1) jumping back (2) jumping back from lotus (1) jumping back. jumping through (1) Jumping between standing postures (1) jumping into lotus (1) Jumping out of Bhjupindasana (1) jumping through (2) justification (1) Kandasana (4) Kapalabhati (2) KAPHALASANA (1) KAPHALASANA and BRAHMASANA (1) Kapil Math (1) Kapilasana (1) kapilasana Advanced B (1) Kapilasana. (1) Kapotasana (49) kapotasana ankles (2) Kapotasana Asana most necessary least significant (1) kapotasana heels (1) Kapotasana in india (1) kapotasana long stay (1) Kapotasana progress videos Dec 08 to Present (1) karandavasana (49) Karandavasana preparation (1) Karandavasana progress 14 day challenge (2) Kareem Abdul-Jabar (1) Karen Haberman (1) Kasyapasana (1) Kausthub Desikachar (4) keeping yoga mats clean (1) Keshava Murthy (1) Kevala kumbhaka (1) key asana (2) KHYF (1) KHYF Scandal (1) Kidney stones (5) kidney stones and yoga (1) kindle (1) Kindle paperwhite (1) Kino (11) Kino Advanced A (1) Kino intermediate series dvd (1) Kino MacGregor (7) Kino trivikramasana (1) knees together kapotasana (1) Knossos (1) Kosha's (1) Kovalam (1) KPJAYI (2) Krama (1) Krishanacharya (2) Krishanamacharya (7) krishanamcharya and the big man (1) Krishmamacharya 2nd (1) krishna (1) Krishnamacharya (147) krishnamacharya 1938 movie (1) Krishnamacharya and Buddhism (1) Krishnamacharya and Burmese Buddhism. (1) Krishnamacharya and drishti (1) krishnamacharya and the gaze (1) Krishnamacharya and tibet (1) Krishnamacharya backbending (1) Krishnamacharya Biography (1) Krishnamacharya chanting (1) Krishnamacharya documentary (1) Krishnamacharya drishti (1) Krishnamacharya hip fracture (1) Krishnamacharya in colour (1) Krishnamacharya in Mysore (1) Krishnamacharya in Tibet (1) Krishnamacharya interview (1) Krishnamacharya jumping (1) Krishnamacharya kumbhaka (1) Krishnamacharya lost photo (1) Krishnamacharya movie (3) Krishnamacharya on Chakras (1) krishnamacharya original asana (1) krishnamacharya poster (1) Krishnamacharya pranayama (1) krishnamacharya pranayama in asana (1) krishnamacharya Primary series. (1) Krishnamacharya quotes (1) Krishnamacharya reading list (1) Krishnamacharya resource (1) Krishnamacharya shoulder stands (1) Krishnamacharya teaching. (2) Krishnamacharya video (1) Krishnamacharya workshop in Leon (1) krishnamacharya. (4) Krishnamacharya. Is Ashtanga hatha or raja yoga (1) Krishnamacharya's 32 headstands (1) Krishnamacharya's Advanced asana (2) Krishnamacharya's Ashtanga Primary series (2) krishnamacharya's Biography (1) Krishnamacharya's certification (1) Krishnamacharya's daughter (1) Krishnamacharya's early Mysore practice. (1) Krishnamacharya's early Mysore works (1) Krishnamacharya's English (1) krishnamacharya's examination (1) Krishnamacharya's guru (1) Krishnamacharya's key asana (1) Krishnamacharya's life saving practice (2) Krishnamacharya's Middle group asana (1) Krishnamacharya's Mysore Yoga students 1941 (1) Krishnamacharya's Original Ashtanga Yoga (1) Krishnamacharya's own practice (3) Krishnamacharya's personal practice (1) Krishnamacharya's practice (1) Krishnamacharya's practice guidelines (1) Krishnamacharya's pranayama (3) Krishnamacharya's pranayama practice (1) Krishnamacharya's second series (1) Krishnamacharya's sun salutation (1) krishnamacharya's Yoga Makaranda (1) Krishnamacharya's Yogasanagalu (2) krishnamacharya7s Ashtanga (1) Krishnamcharya (1) Kristina Ireland (3) Kristina Karitinou (7) Kriya (2) Kumbhaka (31) Kumbhaka and healing (1) Kumbhaka breath retention (1) Kumbhaka for healing (1) kumbhaka ha and tha bandhas (1) Kumbhaka in asana (4) kumbhaka jumping (1) kumbhaka. (1) Kumbhakha (1) kurma purana (1) Kurmasana (2) KYM (2) ladies holiday (2) lagu vajrasanam supta vajrasana (1) Lake Biwa (1) Lamrim (1) Langhana kriya (1) Lara Abiesheikh (1) laughter yoga (1) Layering images (1) learn dance hand mudras (1) Learn pranayama (1) Learn Pranayama mantra (1) Learn Sanskrit (1) Learn to chant (2) learn to float drums (1) Learn to float primary DVD (1) Learning pranayama (1) learning Sanskrit numbers (1) learning sanskrit yoga names (1) Learning Sanskrit. (1) Learning the pranayama mantra (1) Learning the sanskrit names for Ashtanga primary series. learning the Ashtanga vinyasa count (1) Learning Vinyasa Count (1) led 2nd series (1) led Advanced Ashtanga series. (1) Led Ashtanga primary (1) Led Intermediate series (1) led primary (1) Led second series (1) ledt intermediate (1) Left hand tantric yoga (1) leg behind head (3) leg behind head poastures (1) Leg behind head preparation postures (5) leg raises (2) legacy of Hippie movement (1) Leon Workshop (1) Les twins (1) less asana (1) levitating (1) life saving practice (1) Life saving Yoga practice (1) Light on yoga (1) Lille (1) lineage (4) Lineage holder (1) lineage Kausthub Desikachar allegations (1) Linking Asana (1) Lino Miele (6) Lino Miele Ashtanga book (1) Lino Miele primary to Advanced book (1) Lino Miele's pranayama sequence. (1) Live stream of primary. (1) long breathing (1) long stay asana (1) Long Stays in asana (4) long stays. (1) Lori Shepard and Brian Yuen (1) losing practice (1) loss of practice (1) lotus (6) lotus jump back (1) lotus jump through (1) Lotus lifted spun dropped. (1) Lotus no hands (1) lotus sequence (4) lotus subroutines (8) lotus to headstand (5) Louise Ellis (1) lout (1) loving kindness (5) Loving kindness and Yoga Sutras (2) lumbosacral arthritis (1) M.S. Viswanath (Masterji) (1) macrobiotic (3) Madhavan Munusamy (1) Madonna (1) Madonna eka pada sirsasana (1) madonna yoga (1) maha bhandasana (1) maha mudra (1) maha vedha (1) mahabhandasana (1) mahabharata (2) mahamudra (2) Mahavedha (2) Making sushi knife (1) Mala Srivatsan (4) Man of Steel (1) mandala (3) Mandala yoga Bend Usa (1) Manduka (12) manduka bolster (1) Manduka's new Santorini prelate (1) Manju (1) manju jois (30) Manju Jois Bundle (1) Manju Jois TT notes. drishti (1) Manju Pattabhi Jois (2) manju Teacher training (1) Manju TT course Crete (1) Manju TT Crete (1) Manju workshop (1) mantra (1) mantra meditation (2) Mantra pranayama (1) Manu pranayama (1) Manuel Molina (1) Marcus Aurelius (1) Maria Shalimova (1) Maria Villella (2) Marichiyasana (2) Marichiyasana D (2) Marichiyasana G (1) Marichiyasana H (1) Marichiyasna G (1) marichiyasna H (1) Marie HALLAGER Andersen (2) Marie HALLAGER Anderson (1) Marilyn Monroe (1) Mark and Joanne Darby (1) Mark Darby (8) Mark Darby DVD (1) Mark Robberts (1) Mark Singleton (4) Mark Whitwell (1) Mary taylor. subtle body. (1) Masterji (1) Matthew Sweeney (5) Maty Ezraty (3) maya vedha (1) mayaland (1) mayurasana (7) Mcafe (1) Mcafe big macro burger (1) Mea Culpa (1) meaning of asana (1) meaning of yoga (1) meanings of Yoga (1) Meditation (11) Meditation and Ashtanga Vinyasa Yoga (1) Meditative (2) meditative sequence. (1) Meditative subroutines (6) Meghan Currie (1) Melanie Cooper (2) Menstruation (3) mental and emotional abuse against Dr. Kaustaub Desikachar (1) mental Space (1) metta (2) Miami Life center (1) Miley Cyrus (1) Miley Cyrus marichiyasana D (1) Miley Cyrus yoga (1) Mind (1) Mindfulness (1) Mingus (3) minimum asana practice (1) misc primary (6) misc. (22) mitabhashana and mitahara (1) Mixed Mysore room (1) Mixed style Mysore room (1) Modern postural yoga (1) modern yoga (1) Modern yoga narrative (1) modern yoga practice (1) modified Ashtanga (3) modified krouchasana (1) modified pasasana (1) Modified practice (1) modified sun salutation. pranayama bolster (1) modifying practice (1) modifying your practice (1) Monkey mind (1) moola bhandasana (1) moolabhandasana (1) moolabhnadha (2) Moon day (2) Moon days (1) More to Mysore (1) morning practice (1) motivation (4) Mountains (1) Mountains of asana (1) Mr T (1) Mr. A.F. Lara Abiesheikh (1) Mrityunjaya mantra tutorial (1) mudra (5) Mudras (3) mula bandha (4) mula bhandasana (1) mulabhandasana (1) mulabhandha (1) Music (1) My book on Kindle (1) My Early Ashtanga movie (1) My Easter Ashtanga retreat (1) my Mysore room (1) My practice (1) My Practice. (1) My very old practice videos (1) My Vinyasa Yoga practice Book. (1) My workshops (3) My year in posts (7) Mysore (3) Mysore dream (1) Mysore in Maidenhead (1) Mysore Magic Yoga At The Source (1) Mysore map (1) Mysore rule change (1) Mysore sandle soap (1) Mysore shala (2) Mysore Traditions Movie (1) Mysore yoga demonstration 1941 (1) Mysore Yoga Shalas (1) Mysore yoga tradition (2) Mysore? (1) Nada Yoga (1) nagaraya namaha (1) nakrasana (2) namarupa (6) namaskara (1) Nancy Gilgoff (11) natajarasana (1) Natanaga Zhander (1) Nauli (1) Nauli bad for womb? (1) Nauli Kriya (1) navasana to handstand (1) Nespresso (1) Nespresso Pixie (1) NEW BLOG (1) new postures (1) newsletters (40) Nietzsce (1) Nietzsche' (1) Niigata Japan (1) Nike grips (1) Nine bandhas (2) Niralumba sarvangasana (1) niralumba sirsasana (4) niyama (1) No Coffee no prana (1) no hands lotus (1) No merit to speak of (1) No official ashtanga (1) Norfolk Nature reserve (1) Norman Allan (1) norman blair (1) Norman Sjoman (2) Norman Sjoman workshop (1) nostril dominance (1) not about the count (1) Notes to self (7) NYT (1) Object and Objectless Meditation (1) odissi (1) official ashtanga (1) oh my datum (1) OHMME YOGA (2) Old Ashtanga article (1) Old krishnamacharya pictures (1) Old man of hassan (1) old shala (2) old Yoga videos (1) Oleg Flow (1) olympic yoga (1) OM The world of Ashtanga Yogis (1) Omkrasana (1) on blogging (2) on devotion (1) On krishnamacharya (1) On retreats (1) on Series (1) On the meaning of the word yoga (1) on vinyasa (1) on your feet (1) on your feet sequence (1) ondividual ashtanga practice (1) One breath an asana (1) one month chakra bhandasana challenge (2) Only one Ashtanga book (1) opening chant (1) or degenerative joint disease or osteoarthrosis (1) origin of Ashtanga (2) original Ashtanga (3) original ashtanga syllabus (2) Original ashtanga table (1) Original ashtanga vinyasa count (2) original bhagavad gita (1) Original sun salutation (3) original surynamaskara (1) origins of Ashtanga (3) origins of ashtanga. (1) origins of sun salutation (1) Origins of yoga (1) orisgin of Ashtanga (2) Orisginal Ashtanga syllabus (1) Orthodox church (1) Osteoarthritis (1) Osteoarthritis of the spine (1) Outer gazing - Krishnamacharya (1) outtakes (1) overweight (1) oving kindness mantra (1) pachimatanasana (1) Padangustha Dhanurasana (1) Padma mayurasana (1) padmasana (6) padmasana variations (1) painkillers (3) pancha kosha (1) pancha maya (1) paralympics (1) param yoga (1) Paramaguru (2) Paramaguru Sharath R. Jois (1) Paramata (1) parampara (5) Parasarita Padottanasana C (1) Pariṇāma (1) parsva dandasana (2) pasasana (8) paschimottanasana (5) Pashasana (1) pass (1) Patabbhi Jois' nephew (1) patanjali (5) patanjali prayers (1) Patanjali's yoga sutras (1) Pattabhi Jois (38) Pattabhi Jois advanced led A (1) Pattabhi jois Advanced series (1) Pattabhi Jois and Patanjali (1) Pattabhi Jois article (1) Pattabhi Jois asana (1) Pattabhi jois asana photos (1) Pattabhi jois handstand (1) pattabhi Jois interview (2) Pattabhi Jois Led (1) Pattabhi Jois pranayama (1) Pattabhi Jois resources (1) Pattabhi Jois samastithi (1) Pattabhi jois with Krishnamacharya (1) pattabhi Jois. (2) Pattabhi Jois' (1) Pattabhi Jois' pranayama Sequence (1) Pattabhi Jois' Yoga Journal letter (1) Pattabhi joys led primary (1) Paul Gold (1) Paul Harvey (1) peace chants (1) Peg Mulqueen (2) Period (1) Perissa Beach (1) Perter Brooks Mahabharata (1) Pet Cremation (1) Petri Raisanen (2) Petri Räisänen (2) Philippa Asher (2) Philokalia (1) Philosophy (3) Philosophy of Patanjali (1) Phone call (1) phulgenda Sinha (2) Physical Space (1) pinca mayurasana (1) Plagerism (1) Playing flute in asana (1) Pm Modi (1) PM Modi practicing yoga (1) postural yoga practice (1) pottery (1) practice (1) practice guidelines (1) practice report (1) practicing ashtanga at home (1) practicing together (1) Practicing Vinyasa Krama (1) Practicing with Sharath (1) practicing with short arms (1) practicing Yoga at home (1) practicing yoga safely (1) practicing yoga when overweight (1) Prana (1) prana shorts (1) prana vashya yoga (1) pranayama (33) Pranayama : Breath of Yoga (1) Pranayama and meditation (1) Pranayama by Pattabhi Jois (1) Pranayama chant (1) Pranayama chanting meditation (12) pranayama in asana (2) pranayama mantra (3) Pranidhi Varshney (1) prasadana (1) Prashant Iyengar (4) Pratyahara (4) pratyaya (1) Pregnancy (1) Pregnancy and Ashtanga (1) preparation for yoga (1) press to handstand (18) Presse Medicale 1936 (1) primary (2) Primary and 2nd series together (1) primary coming back. (1) primary manual (1) Primary series (1) Primary series book (1) Primary series practice sheets (1) Problems with Ashtanga (3) proficiency in asana (1) Proficient primary (3) progressing through ashtanga series (1) prolite (1) Pungu kukkutasana (2) puraka (1) Puraka (inhalation) (1) puraka kumbhaka (1) Purna matsyendrasana (8) Purusha (3) Pushpam (2) Questions from krishnamacharya's students (1) Questions to krishnamacharya (1) Quietude (1) R. Sharath Jois (2) Radha (2) Rainbowman (1) Raja Bhoja (1) raja kapotasana (2) Raja yoga (2) Rajah of Aundh (1) rajakapotasana (1) rajas and tamas (1) ram (1) rama Asana (1) Rama Mohana Brahmacari (1) Rama Mohana Brahmacharya (1) Ramamohana Brahmachari (1) Ramamohana Brahmachari' (1) ramaswam's newsletters vol 1 and vol 2 (1) Ramaswami (46) ramaswami chanting (3) Ramaswami in UK (1) Ramaswami Interview (1) Ramaswami newsletters (38) Ramaswami on Krishnamacharya (1) Ramaswami on meditation. (1) Ramaswami pranayama (1) Ramaswami resources (1) Ramaswami teaching (2) ramaswami. (1) Ramaswami's key asana (1) Ramaswami's Newsletters Vol 1-3 for Download (2) Ramaswami's Yoga sutra tutorial (1) Ramaswami's yoga sutras (1) Ramaswamin (1) Ramswami yoga (1) Reading list (1) Recaka (exhalation) (1) recaka kumbhaka (1) recheka (1) recheka kumbhaka (1) Relationships (1) relaxed abdomen mayurasana (1) Religiousness in yoga (1) replacing the mac hard Drive (1) Rethymno (1) Rethymno Ashtanga (1) retread (1) Review (2) reviews (44) Reviews. Kino Macgreggor (2) Richard Freeman (22) richard freeman and Pattabhi Jois (1) Richard Freeman five day intensive (1) Richard Freeman intensive (3) Richard Freeman. (1) Richard Schechner (3) right speech (1) Rilke (1) Rinzai Zen (1) rishi (1) rishi series (5) Rishi Series. (1) Rishi Seris (1) Rishi's (1) Rmaswami (1) Robert thurman (1) role models (1) Roots of Yoga (2) runway posters (1) Runway project (1) Ryan Leier (2) Sadhaka: the yoga of B.K.S. Iyengar (1) Safer yoga practice (1) Sahaj Marg (1) Sahaj Marg Meditation (1) sahanavavati tutorial (1) Saharath (1) Salinger (1) Salutations to the Teacher and the Eternal one (4) Samadhi (1) samakonasana kroukachasana challenge (2) Samaria gorge (1) Samkhya (7) Samkhya krika (1) Samyama (3) sañcāra (1) Sandhinirmocana Sutra (1) sanmukha mudra (1) Sanskrit numbers (1) Santorini (4) Saraswati (1) sarvanagasana (6) sarvangasa (3) sarvangasana (5) sarvangasana preparation (1) sat mukhi mudra (1) satvic (1) Satya murthy (1) savasana (1) Śavasana (1) savasana Ashtanga take rest (1) saxophones (1) say (3) sayanasana (1) Sayasana (1) science of pranayama (1) science pertaining to the Self within. adhyātmavidyā (1) seated (2) Seattle Slyer espresso machine. (1) Seductive ashtanga (1) see my (1) sequences and subroutines. (88) Setu Bandhasana and chakra Bandhasana. (1) seven deadlies (1) seven headstands (1) Shadow yoga (1) shakuhachi (1) Shala (3) Shala practice (2) shala trail run (1) Shandor Remete (3) Shang Yen (1) shanmukha mudra (1) Shanti mantra transcriptions (1) Shanti mantras (1) Sharat (1) Sharath (20) sharath / Jois old Video (1) Sharath Advanced A (1) Sharath conference (2) sharath dwi pada sirsasana (1) Sharath interview (1) Sharath jois (3) Sharath led primary (1) sharath primary DVD (3) Sharath Rangaswamy (1) Sharath Rangaswamy Jois (1) Sharath tour dates (1) Sharath Utkatasana exit (2) Sharath virabhadrasana exit (1) Sharath. (1) Sharath's book (2) Sharath's karandavasana (1) Sharath's led primary at Joisyoga NYC (2) Sharath's new book (1) Sharath's practice. (1) Sharath's pranayama video (1) Sharath's Virabhadrasana video (1) Sharpening japanese knives (1) Shiga (1) Shiga prefecture (1) shirsasana (1) Short Ashtanga practice. (1) shoulder stand (1) shoulder stand vinyasas (3) shoulderstand (6) Shoulderstand variations (1) Shoulderstands. (1) Shri Louise (1) Shribashyam (1) Shubogenzo (1) Sick (1) sick bed practice (1) siddhars (1) siddhis (2) SIKSHA VALLI (1) Silent Illumination (1) simhasana (2) Simon Borg-Oliver (10) Simon Borg-Olivier (10) Simon Borg-Olivier pranayama (2) Simon-Borg Oliver (1) Simple core vinyasa Krama practice (4) Sin salutation with mantras (1) sinha (1) sirsasana (17) Sirsasana variation (1) Sirsasana variations (1) sirsasana. headstand (1) SIRSHASANA (2) Sirssana (1) Sisrasana (1) sitali (1) sitali pranayama (1) sitali suryabheda nadi shodana (1) Sivananda (1) skilful practice (1) SKPJ (1) Skydiver Felix Baumgartner breaks sound barrier (1) Slow Ashtanga (6) Slow Ashtanga Osaka (1) slow sun salutation (1) Slowed down 2nd series (1) Slowed down Primary series (1) sma konasana (1) Soap opera practice (1) Sofia Xirotiri (1) SOHAM (1) Sonia Nelson (1) Soto zen (1) Space (1) Spinal sequence (1) Spiritual life (1) Spiritual practice? Yoga philosophy (1) Splashtanga (1) splits (1) spondylosis. Suryanamascara (1) Sri K Pattabhi Jois (8) Sri K. Pattabhi Jois (3) Sri k. Pattabhi Jois memorial (1) Sri K. Pattabhi Jois' legacy (2) SRI T K SRIBHASHYAM (3) Sri TK Sribhashyam (2) Sri. K. Pattabhi Jois (1) Sribashyam sri sribashyam (1) SRIBHASHYAM (1) Srivatsa Ramaswami (56) Srivatsa Ramaswami Story time (1) Srivatsa ramaswami. (2) Srivatsa Ramaswami's (1) Srivatsan (1) steadiness and comfort ( sthhira and sukha). (1) Stillpoint yoga (3) Stoic (1) stoicism (1) stopping yoga clothes from smelling. (1) Straight leg jump through (10) Straight leg jump through. (1) studying with krishnamacharya (1) Subject/Object (1) Subroutines. (2) Subtle body (2) Summary Yoga sutras (1) Sun salitation variations (1) Sun salutation (6) sun salutation mantras (2) sun salutation to directions. (1) sun salutation with mantra (1) Sun salutation with mantras (2) sun salutation with mantras. Suryanamaskara (1) super moon (1) Superman (1) supine (2) Supine sequence (2) supine Subroutines (18) Supoine (1) supra trivikramasana (1) supta kurmasana (8) supta kurmasana Bhuja Dandasana (1) Supta Vajrasana (8) Suptapada Parsvangushtasana (1) Suptaparsva paddanguthasana (1) Surf guitar medley (1) Surrender (3) sury namaskara with mantras (1) surya namaskar (1) surya namaskara (1) suryanamakara (1) Suryanamakara with mantras (1) Suryanamaskara (2) Suryanamaskara with mantras (1) surynamaskara (1) Surynamaskara practice sheet (2) surynamaskara with mantras (1) Suy namaskara (1) svanasanas (1) Swami Bua (1) Swami Hariharananda Aranya (2) Swara yoga (1) Sweat and kidney stones (1) Sweaty practice (1) T. K. Shribashyam (4) T. K. Sribashyam (1) T. Krishnamacharya (2) T.K. Sribhashyam (2) T.R.S. SHARMA (1) Table of asana (2) Taboo (1) Taḍagī Mudra (1) tadasana (5) Taittiriya Upanishad (2) TAN postures (1) Tantric Yoga (1) tapas (2) tatakamudra (2) tatkamudra (1) tatkamudra. (1) tattvas samkhya (1) teacher training (1) Teaching (4) Teaching Ashtanga (2) teaching first vinyasa krama Class (1) teaching yoga Adjusting asana (2) ten breaths in each asana (1) ten second inhale (1) Teos Bernard (1) textual support for kumbhaka in asana (1) The 'Original' Ashtanga yoga Syllabus given to Nancy Gilgoff and David Williams by Sri K Pattabhi Jois in 1974 Mysore (2) The Art of Ashtanga vinyasa (1) the asana before the asana (1) The Ashtanga Key (1) The Ashtanga Yoga Center (1) the breath (2) The Breath of Yoga (1) The breathing God (4) The Complete Ashtanga Yoga Syllabus demonstrated by David Williams (2) The Complete Book of Vinyasa Yoga : Subroutines page numbers (1) The Four Immeasurables (1) the Gita as it was (1) The Indian Review (1) The Jesus prayer (1) THE KALAMA SUTRA (1) The Kumar brothers Vijay Kumar (1) The looting of Yoga (1) the Original gita (3) the Original Yoga Sutras (2) The power of Ashtanga yoga (1) The power of Yoga. (1) The practice place (1) The Purnacarya (1) the purpose of yoga postures (1) the purusha sutra (1) the Science of yoga it's risks and rewards (1) The Shala (1) the Source (2) The Spine (3) The Time-Being (1) The Viniyoga letter (1) The vinyasa count (1) The way back (1) The yoga of breath (1) The yoga Podcast (3) thinking of giving up Ashtanga (1) This is yoga 1941 (1) This is yoga life magazine (1) three gunas (3) Three postures (1) tibet (1) tic tac (10) tic tock (9) tick tocks (5) tictac (2) tictac viparita chakrasana (1) Tim Feldmann (1) Tim Miller (9) Tirieng Mukha Eka Pada Paschimattanasana (1) Tirumular Thirumandiram (1) Tiryangamukha ekapada pascimottanasana (1) Titchwell (1) Titibhasana (1) tittibasana (1) tittibhasana (2) TK Shribhsyam (1) TK Sribashyam (1) TKV Desikachar (3) tolasana (1) Tolstoy (1) Tolstoyism (1) Tom Sewell (1) towards karandavasana (1) tradition (3) traditional yoga (1) Tranquilo (1) transitions (2) Translate (1) Trataka (1) travel (1) Trayumbakum mantra (1) triangamukha Uttanasana (1) trigger point therapy (1) Trikonasana (1) trying yoga (1) tsunami (1) tucking the tailbone. (1) Tudor-Jones (1) tunas (1) tutorial (1) uddiyana bandha (2) Uddiyana bandha in asana (1) uddiyana kriya (1) uddiyana mudra Kino (1) Uji (1) ujjayi (3) underwater yoga (1) unsupported headstand (1) unsupported headstands (2) Upanishads (2) upavishta konasana (1) Urdhava Dhanurasana (2) urdhva dhanurasana (2) Urdhva Kukkutasana (2) Urdhvamukhasvanasana (2) ushtrasana (1) ustrasana (1) Uthpluthi (1) Utkatasana (2) Utkatasana lift (1) utpluthi (1) uttana mayurasana (1) uttanha Shalabhasana (1) Uttarkashi (1) Utthita Hasta Padangusthasana (1) utthita parsvakonasana (1) Uttihita Padangustasa (1) Vairagya (1) vajrasana (3) Vajrasana sequence (1) Valencia Krishnamacharya workshop (2) Valencia workshop (1) vamana Rishi (1) varying allegations of sexual (1) vashitasana (1) vatayanasana (2) vatyanasana (1) Vayu (1) Vayu Siddhi (1) vayus (1) Vedanta (1) vedic peace chants (1) Veena (1) Vegetarian (1) vegetarian burger (1) Vegetarian Minestrone (2) Vibrem five finger shoes (1) Vicarious Yoga (1) Vidyas (1) Vinay Kumar (2) Vinya Kumnar (1) Vinyasa (7) Vinyasa count (3) Vinyasa Krama (39) Vinyasa Krama 200HR TT program (4) vinyasa krama and pregnancy (1) Vinyasa Krama backbending. (1) vinyasa krama daily practice (6) Vinyasa Krama headstands (1) Vinyasa Krama Individual Asana sequences (1) Vinyasa Krama inverted sequence (1) Vinyasa Krama lotus sequence (2) Vinyasa Krama Practice Book (2) Vinyasa Krama Practice Manual (1) Vinyasa Krama practice routine (4) Vinyasa Krama practice sheets (3) Vinyasa Krama prayer (1) Vinyasa Krama Sister blog (1) Vinyasa krama slideshows (1) Vinyasa Krama speeded up Ashtanga slowed down (1) Vinyasa Krama supine sequence (1) Vinyasa krama Teacher training (2) vinyasa krama ten day practice routine (1) Vinyasa Krama triangle subroutines (7) vinyasa krama tt course (2) vinyasa krama videos (1) Vinyasa Krama Yoga Osaka (1) Vinyasa Krama yoga Teacher Training program (1) Vinyasa Yoga (1) Vinyasa Yoga for Youth (1) Vinyasa Yoga practice book (1) VINYASA YOGA PRACTICE BOOK 2ND ED. (1) viparita chakrasana (13) viparita dandasana (3) Viparita Salabhasana (4) vipassana (1) vipraita salambhasana (1) Virabhadrasana (1) Virabhadrasana lift (1) Viranchyasana (3) Viranchyasana A (2) Viranchyasana B (1) Virasana (1) Visesha vinyasa (1) Visvamitrasana (1) Vital points (1) VK arm balance series (1) VK Asymmetric seated sequence (8) VK Bow sequence (2) VK Inverted sequence (2) VK Lotus sequence (2) Vk Meditative poses sequence (1) VK On one leg sequence (9) VK On your feet sequence (5) VK Seated Sequence (10) VK supine sequence (5) Vrischikasana (1) Vrschikasana (1) wabi wabi (1) waht is a Mysore room (1) Warrior stance (1) Washer Woman's syndrome (1) Washing yoga clothes (1) washing yoga towels (1) Watching guruji practice (1) waterproof iPad (1) Way of the pilgrim (1) Whast is Mysore style (1) What I believe (1) What is Ashtanga (1) What is Ashtanga really (2) What is Ashtanga? (1) What is yoga (2) What is Yoga to me (1) What's changed in Ashtanga (2) What's in a name (1) What's not wrong with Ashtanga (1) When I'm laid in the Earth. (1) Where to practice yoga (1) Why meditation (1) why practice mudras. (1) Why practice yoga (1) why rest on moon days (1) Why Yoga (1) wide angle lens (1) Wild Yogi magazine (1) Wildyogi (1) William j Broad (1) willing suspension of disbelief (1) Winnipeg Yoga Shala Canada (1) winter clothing (1) Winter practice (2) Woman and Ashtanga (1) Woman and Yoga (1) Workshop (1) workshop. (1) workshops (1) Wrist pain in Ashtanga (1) Wyatt (2) Wyatt Denney (3) yama (1) yama niyama (5) yamas and niyamas (1) Yamini Murthanna (1) Yamini Muthanna (1) Yoga (4) Yoga Anatomy (1) Yoga and aeging (1) yoga and ageing (1) Yoga and blood circulation (1) yoga and Diet (1) Yoga and modern medicine (1) Yoga and Motherhood (1) Yoga and Osteoporosis (1) Yoga and pregnancy (4) yoga and Spinal health (1) yoga and Sport (1) Yoga and superheros (1) Yoga and the Spine (1) Yoga and weight (1) Yoga and Women (1) Yoga as it was (1) yoga as sport (1) Yoga bibliography (1) yoga bloopers (2) Yoga Body (3) yoga bookshelf (1) Yoga bookshelves (1) Yoga Campus (1) yoga chikitsa (2) Yoga Chikitsa : Healing Techniques and assistance -Manju Jois (1) yoga class size (1) Yoga Dandasana (1) Yoga for Diabetes (1) Yoga for joints (1) Yoga for the three stages of life (4) Yoga for women (1) Yoga for youth (1) Yoga Fundamentals course (1) YOGA GLOSSARY (1) Yoga Gurandam (1) Yoga History (2) Yoga in Britain (1) Yoga in post war Britain (1) yoga in schools (1) Yoga in the west (1) Yoga in UK (1) yoga is not antithought (1) Yoga Journal (2) Yoga Korunta (8) yoga korunti (1) Yoga magazine (1) Yoga Makaranda (22) Yoga makaranda ( part II) (1) Yoga Makaranda asana (1) Yoga makaranda asana list (1) Yoga Makaranda part 2 (1) Yoga Makaranda Part II (2) Yoga makaranda translation. (1) yoga makaranda. (1) Yoga mala (1) Yoga mat bags (2) Yoga mat bags from recycled Kimono's (1) Yoga matbags from recycled kimono material (1) Yoga Meditation (4) Yoga Mela Kripula (1) Yoga mudra (1) yoga mudras (1) Yoga Nidra (1) yoga of action (1) yoga of motion (1) Yoga of the Yogi (1) Yoga on film (1) Yoga on Santorini (1) Yoga Philosophy (7) Yoga Philosophy of Patanjali (2) Yoga raading list (1) yoga rahasya (1) Yoga Rainbow festival (6) Yoga reading list (1) Yoga Science (1) yoga selfies (1) Yoga sex scandals (1) Yoga shorts review (2) yoga Styles (1) Yoga sutra 1:33 (1) Yoga sutra chanted (1) Yoga Sutras (14) Yoga Sutras II-49 (1) Yoga Sutras in plain English (1) Yoga Sutras transliteration (1) Yoga Taravali (1) yoga taravali chant (1) Yoga teacher training. (1) Yoga Therapy (4) Yoga therapy articles (1) Yoga Therapy for Children with Special Needs (2) Yoga tradition of the Mysore palace (1) Yoga Unveiled (1) Yoga Vasistha (1) Yoga Workshop (1) Yoga Workshop USA (1) Yoga yajnavalkya (1) Yoga Zagreb Croatia (1) Yoga: Tradition in the Eyes of Modernity (1) yoga's loss of meaning (1) Yoga's loss of purpose (1) Yoga=Addiction? (1) Yogacarya Krishnamacharya - The Purnacarya (2) Yogacarya Krishnamacharya - The Purnacarya. Edited by Mala (1) YogaGlo (1) Yogakriyas (1) Yogamatters (2) Yoganidrasana (1) Yogāsana-Jaina (1) Yogasanagalu (44) Yogasanagalu asana list (1) yogasanagalu translation (5) Yogasanagalu. (1) Yogasanagalua (1) Yogasynergy (1) Yogavataranam (1) Yogayajnavalkya (1) Yogeshwara Ramamohana Brahmachari (1) Youtube videos (1) YS I:14 (1) Yurt Norfolk camping (1) Yvonne Millerand (2) Yyvonne milerand (1) Zen Bones. Centering practice (1) zen circles (1) Zen Flesh (1) Zen training (1) Zoë Slatoff-Ponté (1)

A Reminder

from Kalama sutra, translation from the Pali by Bhikkhu Bodhi This blog included.

"So, as I said, Kalamas: 'Don't go by reports, by legends, by traditions, by scripture, by logical conjecture, by inference, by analogies, by agreement through pondering views, by probability, or by the thought, "This contemplative is our teacher." When you know for yourselves that, "These qualities are unskillful; these qualities are blameworthy; these qualities are criticized by the wise; these qualities, when adopted & carried out, lead to harm & to suffering" — then you should abandon them.' Thus was it said. And in reference to this was it said.

"Now, Kalamas, don't go by reports, by legends, by traditions, by scripture, by logical conjecture, by inference, by analogies, by agreement through pondering views, by probability, or by the thought, 'This contemplative is our teacher.' When you know for yourselves that, 'These qualities are skillful; these qualities are blameless; these qualities are praised by the wise; these qualities, when adopted & carried out, lead to welfare & to happiness' — then you should enter & remain in them. Buddha - Kalama Sutta
Creative Commons License
Ashtanga Vinyasa yoga at home by Anthony Grim Hall is licensed under a Creative Commons Attribution 3.0 Unported License.
Permissions beyond the scope of this license may be available at