This blog is essentially 'sleeping'.

I've deleted or returned to draft 80% of the blog, gone are most, if not all, of the videos I posted of Pattabhi Jois, gone are most of the posts regarding my own practice as well as most of my practice videos in YouTube, other than those linked to my Vinyasa Yoga Practice Book).

Mostly I've just retained the 'Research' posts, those relating to Krishnamacharya in particular.

Blog Comments are turned off, there are no "members" of this blog .

Saturday, 12 May 2012

More Yogasanagalu translation; Final page of first section.

Below is the final page of the first section and directly follows the asana table from yesterday.


TRANSLATION

“Vinayasas” many people are curious about its secret.  Some others want to know its basis.  I agree.

“प्रायत्नशैथिल्यानन्तसमापत्तिभ्याम्”
“prayatnashithilyanantasamapattibhyam”
 
Please see Patanjala yogasutra and Vyasabhasha (P 2, S 47)

Enjoy the two types.

Vachaspathi Mitra in that commentary

“सांसिद्धिकोहिप्रयत्न​ः शरीरधारको न योगांगस्योपदेश्टव्यासनस्य कारनम्।  तस्मात् उपदेश्टव्यासनस्यायमसाधकः विरोधीच स्वाभाविकः प्रयत्नः। तस्य च याध्रुच्छिकासनहेतुतया सननियमोपहंत्यत्वात्॥”

“Saamsiddhiko hi prayatnah shariradharako na yogangasyopadeshtavyasanasya kaaranam.  Tasmat upadeshtavyasanasyayamashadhakah virodhi cha swabhavikah prayatnah.  Tasya cha yadruchhikasanahetutayaa sananiyamopahamtyatvat.”

“तसात् उपधिश्टनियमासनम् अभ्यस्यता स्वाभाविकप्रयत्नशैथिल्यात्मा प्रयत्न अस्तेयः नान्यथा उपदिश्टं आसनं सिध्यतीति स्वाभाविकप्रयत्नशैथिल्यं आसनसिद्धिहेतुः।”

“tasmat upadishtaniyamaasanam abhyasyataa svaabhaavikaprayatnashaithilyaatmaa prayatna asteyah naanyatha upadishtam asnam sidhyateeti svaabhavikaprayatnashaithilyam asanasiddhihetuh”

“अनन्ते व्या-नागनायके स्थिरतरपणासहस्रविध्रुतविश्वंबरामंढले समापन्नं चित्तं आसनं निर्वर्तयतीति”

“Anante vya-naganayake sthiratarapanasahasravidhrutavishwambaramandale samapannam chittam asanam nirvartayateeti”

Therefore, how many breathings for which asana?  When is inhalation?  When is exhalation? In what way? When body is stretched forward, inhalation or exhalation? What about when you raise your head? To know this mystery and practice in order is called Vinayasa.  These along with the significance of each asana will be discussed in 1 to 32.  

----------------------------------------------------------------------------

Notes
The translation and treatment of the sutra below is from Patanjali's Yoga Sutras Based on the teaching of Srivatsa Ramaswami by Pamela Hoxsey and taught on the Vinyasa Krama teacher training course that I attended in 2010. This is relevant because Ramaswami spent over thirty years, from the 1950's to the 1980's, as Krishnamacharya's student.
Yoga Sutra II-47 


प्रायत्नशैथिल्यानन्तसमापत्तिभ्याम्


“prayatnashithilyanantasamapattibhyam”

"prayatna - effort (of life which is breathing)

saithilya - smooth (make it smooth)

ananta-samapattibhyam:

          ananta -breath

          samapattibhyam - focusing on it

By making the breath smooth (and long), and by concentration or focussing the mind on the breath, the perfection of the posture is obtained. Note: Krishnamacharya interprets this sutra differently than other teachers. he gives the correct technical meaning (in this context) fromn prayatna or Jivana prayatna, or effort of life which is breath. he says that it is the breath that should be made smooth and effortless, not the posture. it is not physical; it is the breathing" p55 ------------------------------- I also found an Online edition of The Yoga Sutras with Vyasa's commentary and the explanation/gloss called tattva- vaicardi of Vachaspati Micra ( Mitra) quoted in length in the text above.
http://archive.org/details/yogasystemofpata00wooduoft

II- 47. By relaxation of effort or by a [mental] state-of-balance with reference to Ananta [A posture] results. With these words the sentence is completed. When efforts cease the posture is completed,so that there is no agitation of the body. Or the mind-stuff comes into a balanced-state with reference to Ananta and produces the posture. (Vyasa) Having stated what the postures are, he tells what are the means of attaining them. 47.By relaxation of effort or by a [mental] state-of-balance with reference to Ananta. A natural effort sustaining the body is not the cause of this kind of posture which is to be taught as an aid to yoga. For if its cause were such, the preaching of it would be purposeless in that it could be naturally perfected. Therefore this natural effort does not accomplish this kind of posture which is to be taught and is contrary [to it]. For in so far as this [natural posture] is the cause of an arbitrarily chosen posture it is the destroyer of the specific kind of posture. Consequently a man, practising the specific posture as taught, should resort to an effort which consists in the relaxation of the natural effort. Otherwise the posture taught cannot be accomplished. Or . . . with Ananta,^ the Chief of Serpents, who upholds the globe of the earth upon his thousand very steadfast hoods, [with him] the mind-stuff comes into a balanced state and produces the posture". (Vachaspati Micra)

translation of Ananta
Ananta is another name for Vishnu (the infinite. limitless one) and often gets translated as infinity, some argue that the meaning of this sutra is to meditate upon the infinite, Sankara puts it like this,

"When the mind attains samadhi on that which stands pervading all existence, the posture is perfected, made firm" p275  

As Ramaswami states
"Krishnamacharya interprets this sutra differently than other teachers..."

"There is another interpretation of the word ananta. The...meaning comes from the word "ana" which means to breathe. Ana means preach. for example, prana, apana, vyana, and so on. They all come from the root ana, to breath. So, here ananta refers to the breath. Ananta Samapatti is to focus your attention on the breath. Anatasamapatti is to focus your attention on the life force which is the breath." p97-98

3 comments:

  1. Hi Grimmly,

    On taking a more closer look at that sentence (Enjoy the two types), I want to clarify a little bit more. It seems I missed a single letter that can change the meaning slightly. The more accurate translation should be " Both type of people, be happy (enjoy)". K seems to be addressing two type of practitioners.

    Satya

    ReplyDelete
  2. Thanks Satya, have changed it in the post. I've added Ramaswami's translation of the sutra and commentary with his notes on Krishnamacharya's interpretation in the notes.

    ReplyDelete
  3. love this zeroing in on the vinyasa definition! gotta get to practice now!

    ReplyDelete

Note: only a member of this blog may post a comment.

Follow by Email

Print

A Reminder

from Kalama sutra, translation from the Pali by Bhikkhu Bodhi This blog included.

"So, as I said, Kalamas: 'Don't go by reports, by legends, by traditions, by scripture, by logical conjecture, by inference, by analogies, by agreement through pondering views, by probability, or by the thought, "This contemplative is our teacher." When you know for yourselves that, "These qualities are unskillful; these qualities are blameworthy; these qualities are criticized by the wise; these qualities, when adopted & carried out, lead to harm & to suffering" — then you should abandon them.' Thus was it said. And in reference to this was it said.

"Now, Kalamas, don't go by reports, by legends, by traditions, by scripture, by logical conjecture, by inference, by analogies, by agreement through pondering views, by probability, or by the thought, 'This contemplative is our teacher.' When you know for yourselves that, 'These qualities are skillful; these qualities are blameless; these qualities are praised by the wise; these qualities, when adopted & carried out, lead to welfare & to happiness' — then you should enter & remain in them. Buddha - Kalama Sutta

Labels

#proficientprimaryproject (1) 10 point way to health (1) 100 years of beatitude (1) 2nd series headstands (1) 2nd series list (1) 3rd edition Vinyasa Krama Practice Book (1) 7 deadlies. (1) 84 key asana (2) 8f key postures (1) A. G. Mohan (1) acro yoga (1) Advanced A B C D list (1) AG Mohan (2) Ajaan Lee (1) alternate breathing in ashtanga (1) alternatives to asana (1) alternatives to headstand (1) Angela Jamison (1) Ante-natel Yoga (3) Anthar Kumbhakam (1) Antharanga Sadhana (1) applied anatomy and physiology of yoga (1) Ardha Baddha Padma Paschimattanasana (1) Ardhomukhasvanasana (1) arm balances (1) asana lists (1) Asana madness (1) Ashtanga (3) Ashtanga Advanced series (1) ashtanga and age (1) ashtanga and ageing (1) Ashtanga as it was (2) ashtanga authorisation (1) Ashtanga breathing (1) Ashtanga certification (1) Ashtanga cheat sheets (1) Ashtanga history (2) Ashtanga illustrations (1) Ashtanga in midlife (1) Ashtanga intermediate (1) Ashtanga mysore (1) Ashtanga primary (1) Ashtanga primary series list (1) Ashtanga reading list (1) Ashtanga Rishi approach. (9) Ashtanga teacher Authorisation (1) Ashtanga vinyasa (2) Ashtanga Vinyasa Krama (1) Ashtanga Yoga (3) Ashtanga young boys (1) asymm (1) Asymmetric asana (1) AVIDYA (1) back bending (1) backbending (2) baddha konasana (1) badha matsyendrasana (1) badha padmasana (1) Bahauddin Dagar (1) Bandhas (6) Bansuri Holliger (t)air(e) for solo flute (1) Basti. Neti (1) beginner yoga reading list (1) bhagavad gita (1) Bhagavadagita (1) Bharadvajrasana (1) Bharadvajrasana long stay (1) Bharatanatyam (1) Bhaya Kumbakam (1) Bhoja's commentary on Yoga sutras (1) Bhuja Dandasana (1) Big people can do you (1) biography of Krishnamacharya (1) BNS Iyengar (2) bow (1) Bow sequence (5) breath holding (1) Breath of god (1) Breath of gods (1) Breath of the Gods (3) breathing asana (1) breathing in Ashtanga (1) Buddhasana (1) Burmese buddhism (1) Camel walk (2) caturanga Dandasana (1) chakea (1) Chakras (3) chakrasana (1) chanting in asana (1) Chanting the yoga sutras. (1) chanting yoga sutras (1) coming back to Ashtanga (1) comparison of drishti (1) Dasha diirgha rechaka puuraka (1) David Williams (1) Der Atmande Gott (1) Der Atmende gott (2) dhanurasana (2) Dharana (3) Dharana focal points (1) Dhouti (1) Dhouti kriya (1) Dhyana (3) Did Krishnamacharya speak English (1) Dido and Aeneas (1) Dido's lament (1) Do we need an Advanced series (1) drishti (5) Durvasasana (1) Dvipada sirsasana (1) dwi pada sirsasana (1) dwipadapitam (1) Early Ashtanga (1) Easter Krishnamacharya retreat (1) Eka pada raja Kapotasana (1) eka pada sirsasana (1) EKAPADA VIPARITAKARANI (1) Emergence du Yoga (1) Emergence of Yoga (4) Emurgence du Yoga (1) extended stays (2) FAT PEOPLE CAN'T DO YOGA? Fat people Can do Yoga (1) flute (1) Forest tradition (1) four Immeasurable and yoga (1) four Immeasurable and yoga sutras (1) full vinyasa (2) Ganda Bherundasana (1) Garbha Pindasana (1) getting in to full lotus (1) gita as it was (1) grimmly's retreat (1) grimmly's workshop (1) Guru's of Modern Yoga (1) halasana (1) handstands (1) hanumanasana (2) Hatha Yoga Pradipka (1) headstand (10) headstand variations (1) headstands (2) heart stopping (1) heart stopping experiment (1) hidden asana (1) History of Asana (1) History of Ashtanga (1) history of Yoga (1) House recommendations (2) how to breath in asana (1) how to chant the yoga sutras (1) How to do a headstand (1) how to do lotus (1) how to learn ashtanga (1) in defense of asana (1) Indian cosmology (3) Indian evolution (3) Indra Devi (1) Inner gazing (1) insight meditation (1) Intermediate series (1) internal drishti (2) inversions (3) inverted sequence (3) inverted subroutines (9) iyengar (1) Iyengar jumping (1) Iyengar practicing ashtanga (1) Iyengar. 1938 Krishnamacharya movie (3) Iyengar's ashtanga (1) jalandhara bandha (1) Jivatma (1) john Scott (1) Jump back jump through (5) jump back seven elements (7) Kapalabhati (1) Kapilasana (1) Kapotasana (1) Kausthub Desikachar (1) KPJAYI (1) Krishanacharya (2) Krishanamacharya (3) krishanamcharya and the big man (1) Krishnamacharya (84) Krishnamacharya and Buddhism (1) Krishnamacharya and Burmese Buddhism. (1) Krishnamacharya Biography (1) Krishnamacharya chanting (1) Krishnamacharya documentary (1) Krishnamacharya drishti (1) Krishnamacharya in colour (1) Krishnamacharya in Mysore (1) Krishnamacharya in Tibet (1) Krishnamacharya interview (1) Krishnamacharya movie (3) Krishnamacharya shoulder stands (1) Krishnamacharya teaching. (2) krishnamacharya. (1) Krishnamacharya's 32 headstands (1) Krishnamacharya's Advanced asana (1) krishnamacharya's Biography (1) Krishnamacharya's daughter (1) Krishnamacharya's early Mysore practice. (1) Krishnamacharya's early Mysore works (1) Krishnamacharya's English (1) Krishnamacharya's guru (1) Krishnamacharya's life saving practice (2) Krishnamacharya's Mysore Yoga students 1941 (1) Krishnamacharya's own practice (2) Krishnamacharya's personal practice (1) Krishnamacharya's practice (1) Krishnamacharya's pranayama (2) Krishnamacharya's pranayama practice (1) Krishnamacharya's second series (1) Krishnamacharya's sun salutation (1) krishnamacharya's Yoga Makaranda (1) Krishnamacharya's Yogasanagalu (2) Krishnamcharya (1) Kriya (1) Kumbhaka (10) Kumbhaka and healing (1) kumbhaka. (1) Lamrim (1) Langhana kriya (1) learn dance hand mudras (1) learning Ashtanga (1) learning original ashtanga (1) learning Sanskrit numbers (1) Learning Vinyasa Count (1) leg behind head (1) Leg behind head preparation postures (3) Life saving Yoga practice (1) lineage (1) Lino Miele (1) long stay asana (1) Long Stays in asana (2) lotus (2) Lotus lifted spun dropped. (1) lotus sequence (1) lotus subroutines (7) lotus to headstand (2) lout (1) loving kindness (1) Loving kindness and Yoga Sutras (2) maha vedha (1) mahabharata (1) mahamudra (1) Mahavedha (2) Mala Srivatsan (4) mandala (3) manju jois (2) Mantra pranayama (1) Marichiyasana G (1) Marichiyasana H (1) Mark Singleton (2) maya vedha (1) mayurasana (2) meaning of asana (1) meaning of yoga (1) meanings of Yoga (1) Meditation (4) Meditative (2) Meditative subroutines (6) Mindfulness (1) Mixed Mysore room (1) Mixed style Mysore room (1) Modern postural yoga (1) modified Ashtanga (1) moolabhnadha (2) mudra (4) Mudras (2) mula bandha (2) Mysore (1) Mysore Traditions Movie (1) Mysore yoga (1) Mysore yoga demonstration 1941 (1) Mysore yoga documentary (1) Mysore yoga film (1) Mysore yoga traditions film (1) Mysore yoga traditions retreat (1) Mysore yoga tradtidions (1) namarupa (4) Nancy Gilgoff (3) natajarasana (1) Nauli (1) newsletters (3) Nine bandhas (1) Niralumba sarvangasana (1) niralumba sirsasana (3) Norman Allen (1) Norman Sjoman (1) Notes to self (1) Old krishnamacharya pictures (1) Old man of hassan (1) origin of Ashtanga (1) original Ashtanga (3) original ashtanga syllabus (1) original bhagavad gita (1) Original sun salutation (2) original surynamaskara (1) origins of Ashtanga (2) origins of sun salutation (1) Outer gazing - Krishnamacharya (1) overweight (1) Padangustha Dhanurasana (1) padmasana (2) Paramata (1) pasasana (1) paschimottanasana (1) patanjali (1) Pattabhi Jois (5) Pattabhi Jois sexual assault allegations (1) pattabhi Jois. (2) Pattabhi Jois' (1) Philosophy (3) phulgenda Sinha (1) Playing flute in asana (1) practice guidelines (1) Practicing Vinyasa Krama (1) practicing yoga safely (1) practicing yoga when overweight (1) pranayama (9) pranayama in asana (2) pranayama mantra (1) Pratyahara (1) preparation for yoga (1) Presse Medicale 1936 (1) Primary series (1) proficiency in asana (1) puraka (1) Puraka (inhalation) (1) puraka kumbhaka (1) Purusha (3) Questions from krishnamacharya's students (1) Questions to krishnamacharya (1) Raja Bhoja (1) raja kapotasana (1) Rajah of Aundh (1) ram (1) Rama Mohana Brahmacari (1) Rama Mohana Brahmacharya (1) Ramamohana Brahmachari (1) ramaswam's newsletters vol 1 and vol 2 (1) Ramaswami (13) Ramaswami Interview (1) Ramaswami on Krishnamacharya (1) Ramaswami pranayama (1) ramaswami. (1) Ramaswami's Newsletters Vol 1-3 for Download (1) Ramaswami's Yoga sutra tutorial (1) Ramaswami's yoga sutras (1) Ramswami yoga (1) Reading list (1) Recaka (exhalation) (1) recaka kumbhaka (1) recheka (1) Relationships (1) returning to Ashtanga (1) reviews (1) richard freeman and Pattabhi Jois (1) Richard Schechner (2) rishi series (5) Safer yoga practice (1) Salutations to the Teacher and the Eternal one (4) Samadhi (1) Samaria gorge (1) Samkhya (4) Samkhya krika (1) Samyama (3) sanmukha mudra (1) Sanskrit numbers (1) sarvanagasana (6) sarvangasa (2) sarvangasana (3) sarvangasana preparation (1) sat mukhi mudra (1) say (3) Sayadaw (1) seated (2) sequences and subroutines. (88) shakuhachi (1) Shandor Remete (1) shanmukha mudra (1) Sharath jois (1) shoulder stand (1) shoulder stand vinyasas (3) shoulderstand (4) Shoulderstands. (1) Shribashyam (1) simhasana (2) Simon Borg-Oliver (6) Simon Borg-Olivier (1) sinha (1) sirsasana (12) Sirsasana variations (1) sirsasana. headstand (1) SIRSHASANA (1) Sisrasana (1) sitali suryabheda nadi shodana (1) Sonia Nelson (1) Spinal sequence (1) SRI T K SRIBHASHYAM (2) Sri TK Sribhashyam (1) Srivatsa Ramaswami (16) Srivatsa Ramaswami's (1) Srivatsan (1) steadiness and comfort ( sthhira and sukha). (1) studying with krishnamacharya (1) Subroutines. (2) Subtle body (1) Sun salutation (4) sun salutation mantras (1) sun salutation with mantra (1) sun salutation with mantras. Suryanamaskara (1) supine (1) supine Subroutines (18) Supoine (1) supta kurmasana (1) Suptapada Parsvangushtasana (1) Suptaparsva paddanguthasana (1) sury namaskara with mantras (1) surya namaskar (1) suryanamakara (1) Suryanamakara with mantras (1) surynamaskara (1) T. K. Shribashyam (3) T. K. Sribashyam (1) T.K. Sribhashyam (2) Table of asana (1) TAN postures (1) tatakamudra (2) tattvas samkhya (1) ten breaths in each asana (1) The 'Original' Ashtanga yoga Syllabus given to Nancy Gilgoff and David Williams by Sri K Pattabhi Jois in 1974 Mysore (1) the asana before the asana (1) the breath (1) The breathing God (4) The Complete Book of Vinyasa Yoga : Subroutines page numbers (1) The Four Immeasurables (1) The Indian Review (1) THE KALAMA SUTRA (1) the Original gita (2) the Original Yoga Sutras (2) The Purnacarya (1) The Viniyoga letter (1) This is yoga 1941 (1) This is yoga life magazine (1) tibet (1) Tirieng Mukha Eka Pada Paschimattanasana (1) Tirumular Thirumandiram (1) tittibhasana (1) TK Shribhsyam (1) TKV Desikachar (1) tradition (1) Trataka (1) Trikonasana (1) TRS Sharma (2) uddiyana bandha (2) uddiyana kriya (1) uddiyana mudra Kino (1) ujjayi (1) unsupported headstands (2) urdhva dhanurasana (1) Urdhvamukhasvanasana (1) ushtrasana (1) utthita parsvakonasana (1) vajrasana (1) Veena (1) Vinay Kumar (1) Vinyasa (1) Vinyasa count (2) Vinyasa Krama (11) Vinyasa Krama 200HR TT program (1) Vinyasa Krama practice routine (1) Vinyasa Krama practice sheets (1) Vinyasa Krama Sister blog (1) Vinyasa Krama speeded up Ashtanga slowed down (1) Vinyasa Krama triangle subroutines (7) Vinyasa Yoga (1) Viparita Salabhasana (1) vipassana (1) vipraita salambhasana (1) Virasana (1) Vital points (1) VK Asymmetric seated sequence (8) VK Bow sequence (1) VK Inverted sequence (1) VK Lotus sequence (1) VK On one leg sequence (7) VK On your feet sequence (2) VK Seated Sequence (7) VK supine sequence (1) When I'm laid in the Earth. (1) Why meditation (1) why practice mudras. (1) Why practice yoga (1) Why Yoga (1) Wildyogi (1) Yamini Murthanna (1) Yoga (4) yoga and ageing (1) Yoga and pregnancy (3) Yoga and weight (1) Yoga Body (1) Yoga for Diabetes (1) Yoga for the three stages of life (4) Yoga for women (1) Yoga Gurandam (1) Yoga Korunta (3) yoga korunti (1) Yoga Makaranda (10) Yoga makaranda ( part II) (1) Yoga makaranda asana list (1) Yoga Makaranda part 2 (1) Yoga Makaranda Part II (2) Yoga makaranda translation. (1) yoga makaranda. (1) Yoga Meditation (1) yoga mudras (1) Yoga Nidrasana (1) yoga of action (1) yoga of motion (1) Yoga Philosophy (5) Yoga raading list (1) Yoga Rainbow festival (1) Yoga Science (1) Yoga sutra 1:33 (1) Yoga Sutras (3) Yoga Sutras II-49 (1) Yoga Sutras transliteration (1) Yoga therapy articles (1) Yoga Therapy for Children with Special Needs (1) Yoga tradition of the Mysore palace (1) Yoga Vinyasa yoga (1) Yoga yajnavalkya (1) Yogacarya Krishnamacharya - The Purnacarya (2) Yogacarya Krishnamacharya - The Purnacarya. Edited by Mala (1) Yogakriyas (1) Yogasanagalu (32) Yogasanagalu asana list (1) yogasanagalu translation (4) Yogasanagalua (1) Yogayajnavalkya (1) Yogeshwara Ramamohana Brahmachari (1) Yvonne Millerand (2) Yyvonne milerand (1)